KEGG   Desulfohalobium retbaense: Dret_2179Help
Entry
Dret_2179         CDS       T00989                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
drt  Desulfohalobium retbaense
Pathway
drt00330  Arginine and proline metabolism
drt00332  Carbapenem biosynthesis
drt01100  Metabolic pathways
drt01130  Biosynthesis of antibiotics
drt01230  Biosynthesis of amino acids
Module
drt_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:drt00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dret_2179
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Dret_2179
Enzymes [BR:drt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Dret_2179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA VWA_CoxE HAD
Motif
Other DBs
NCBI-ProteinID: ACV69463
UniProt: C8X4W6
Position
complement(2482956..2484092)
Genome map
AA seq 378 aa AA seqDB search
MAVSERDQILKRARCVVVKVGSAVLTADDGLDLRVINRLADQLATLHDQGRQIVLVSSGA
VAAGRRDIQPRGDLSLPLKQAASAVGQGRLMRAYEDAFERYGKTCAQILLTRSDLKSRQR
YLNARNTFATLLDKRIIPIVNENDTVAVDELQFGDNDSLATLLLNIVEGELLVNLTSAQG
VCSGNPAEDSRAALMPEIPDIHELDLEQLCRGKTSSGSGGMYSKLLAARRAAQLGVPTLV
VSGRERFVLERVFGGEALGTWVQAEKRAVSRRKFWMAYNLDPAGSLVVDDGAARALRDKG
KSLLPAGVVQVQGGFEEGALVRILDASGAPIGVGLSNYSAAALRKIQGRSSHCIQDALGE
CPYEEVVHRDNLLLDAAF
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggccgtttctgagcgcgaccagatcctgaagcgggcccgctgtgtcgtggtcaaggtt
ggcagcgctgtgctgaccgcagacgacgggcttgaccttcgggtcatcaatcgcctggcg
gaccagttggcgaccctgcacgatcagggacggcagatcgttctggtatcctcaggcgct
gttgctgccgggcgccgggatatccagccccggggtgatttgtcgttgccgttgaaacag
gcggcctccgccgtcggtcagggccggctgatgcgggcttacgaagacgcttttgaacgc
tacggcaagacctgcgcccagatcttgctgacccgctccgatctcaaaagtcggcaacgg
tatctcaatgcccggaacaccttcgctaccttgctggacaagcgaattattccgatcgtc
aacgaaaatgacaccgtcgccgtcgacgaactccagttcggggataatgattccttggcg
accctgttactcaacattgttgagggagaattgcttgtgaatttgacctcggcgcagggg
gtatgttccggcaatccggccgaggattcccgggcggcattgatgccggagatccccgac
attcacgagttggacctggaacagctctgccgcggcaagaccagtagcggttccgggggc
atgtacagcaagcttctcgcggcgcggcgggctgcccagttgggcgttcctaccctggtc
gtgtccggccgggaacggtttgtcctggaacgggtttttggaggggaagctctgggaacc
tgggtgcaagccgaaaaacgggctgtttcgcgccgcaaattctggatggcgtataatctt
gatccggccggatccctggtcgttgacgacggggcggcaagggccctgcgggacaaaggc
aaaagccttttgcccgcaggtgtggtccaggtccagggcggatttgaagaaggcgctctg
gtccggattctggatgccagtggcgcaccgatcggggtcggtttgtccaactacagcgcc
gcagccttgcgcaaaatccaggggcgctcaagccattgtattcaggatgctctgggcgag
tgtccatatgaagaggtcgtgcaccgggacaatctgctgctcgatgcggctttttaa

DBGET integrated database retrieval system