KEGG   Desulfohalobium retbaense: Dret_2240Help
Entry
Dret_2240         CDS       T00989                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
drt  Desulfohalobium retbaense
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:drt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Dret_2240 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dret_2240 (pyrB)
Enzymes [BR:drt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Dret_2240 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2543858..2544790
Genome map
AA seq 310 aa AA seqDB search
MHWPHKDLLSIQQLTSQEIEHIFDLALKFAEINQRPVKKVPTLKGKSVVLFFAEPSTRTK
ISFDMAGKRLSADTFSLAQSGSSLQKGESLSDTALTLQAMHPDAIVLRHGASGASAYLAR
QLDCAVINAGDGWHAHPTQALLDGFSLFQVWESFAGKNVLLLGDIAHSRVARSDIELLTK
LGAKVRVCAPRTLLPPALKSWPVEIEQDLGRACQDMDAVICLRLQLERQQAGLLPDLREY
ARHFGLGPAHLSHARTGARILHPGPINRGIEIAAELADAPNSLILDQVSSGVATRMALLY
LYLTSTREEA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgcactggccgcacaaggatctgctcagtatccagcagctgacgtctcaggaaatcgaa
cacatcttcgatctcgctctcaaattcgccgaaatcaaccaacgcccggtcaaaaaggtc
ccgaccctcaaaggcaaaagtgttgtgctctttttcgccgaacccagcacacggaccaaa
atctcctttgacatggccggcaagcggctttcggccgacacattttcgctggcccagtcc
ggcagcagcttgcaaaaaggcgagagcctgagcgataccgccctcacccttcaggccatg
catccggacgccattgtcttgcgccatggggccagcggggcctcggcctatctcgcccgc
cagctcgactgcgcggttatcaatgccggtgacggctggcacgcccacccgacgcaggcc
ctgctcgacggcttcagcctgtttcaggtctgggaatcctttgcgggcaagaatgtgctg
ctgctcggcgacatcgcccacagccgggtcgcgcgctcggatatcgaactcttgaccaag
ctcggcgccaaggtacgggtctgcgccccgcggaccctgcttccgccggccctgaagtca
tggccggtggagatcgagcaggatttgggtcgggcctgtcaggacatggacgcggtcatc
tgcctgcgcttgcaactcgaacgccagcaggccgggcttttgcctgatctgcgggaatac
gcccgccacttcggcctggggccggcccatctgagccacgcccggacaggggcccgaatc
ctgcacccggggcccatcaatcgcgggatcgaaatcgctgcggaactggccgatgccccg
aactcgctgatcctggaccaagtctccagcggcgtggccacacgtatggcgctgctctat
ctctatctgacgtccactcgggaggaagcctga

DBGET integrated database retrieval system