KEGG   Desulfotomaculum ruminis: Desru_0014Help
Entry
Desru_0014        CDS       T01518                                 

Definition
pyridoxal-5'-phosphate-dependent protein subunit beta
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dru  Desulfotomaculum ruminis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dru00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desru_0014
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desru_0014
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Desru_0014
Enzymes [BR:dru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Desru_0014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
18614..19822
Genome map
AA seq 402 aa AA seqDB search
MSYVTHLECSKCNKQYNSEEVHQLCECGAPLIVKYDLARIKENFRKEDLKDREPSLWRYW
ELLPLKDKKNLVSLGEGMTPIIKMEVAGPEIGLNNLYLKDEGIIPSGTFKSRGATVGVSR
AKELGIKTLAMPTNGNAGASWSTYGARAGIKSVIVMPQDAPEITRNECAITGADLYLVDG
LISDAGKIVARAVQKYGWFDVSTLKEPYRIEGKKTMGLEIAEQFNWEVPDVILYPTGGGV
GIIGIYKALRELQTIGWIGEKMPRLVAVQAEGCAPIVKAWEEKKTESEFWNNASTCAFGI
TVPKALGDFLVLDAIYKTNGCAVAIADNDLLEAQAVLAAKEGTFVCPEGASLYSAARKLR
EQGWIKENEKVVLLNTGTGLKYPETVNVKVPLLQPNDNIPEA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagttatgtaacccatctagaatgctcaaaatgtaataaacagtacaacagtgaagaa
gttcatcaactgtgtgagtgtggtgctcctttgattgttaaatacgacttggctcgtatt
aaagagaactttcgcaaggaagatttaaaagatcgcgaacctagtttgtggcgttactgg
gagttgctgcccttgaaggataaaaagaatctggtttctcttggtgaaggcatgacccct
ataattaagatggaagtggcaggtcctgaaatcgggttaaataatctttatctgaaggac
gaagggattattccttcgggtacttttaaatcccgtggcgctactgtgggtgtttccaga
gcaaaggaacttggtatcaagaccttggctatgcccaccaacggtaatgccggtgcttct
tggtccacctatggtgcaagagcgggtattaaatcagttatagtaatgccccaggatgcg
ccggaaatcacccgtaacgaatgtgcaattaccggtgcggacctttatctagtggatgga
ttaattagtgatgctggtaaaattgttgctagagcagtacaaaaatatggatggttcgac
gtttctaccctgaaagagccttatcgtattgaaggtaaaaagacaatgggtcttgaaatt
gccgagcagtttaactgggaagttcccgatgttattctctatcccactggtggtggcgta
ggtatcattggtatttacaaagcgctgagagaattacagacaataggttggattggtgag
aaaatgccgcgtctggtggctgtacaagccgaaggttgcgctcccattgttaaagcttgg
gaagaaaagaaaacggaatccgaattctggaacaacgcatccacctgtgcttttggtatc
actgttccaaaagccctgggtgacttccttgtgctggatgcaatttacaagactaatggc
tgcgcggttgctattgcagataatgatttattggaagctcaggctgtgttggctgccaaa
gaaggtacctttgtttgtcccgaaggcgcatctctgtatagtgcagctagaaaactgaga
gaacaaggctggattaaagaaaacgaaaaagtggtgctattgaataccggaaccggtctg
aaatatcctgaaactgtaaatgtaaaagtacctcttcttcagcccaatgataatatccct
gaggcttaa

DBGET integrated database retrieval system