KEGG   Desulfotomaculum ruminis: Desru_0163Help
Entry
Desru_0163        CDS       T01518                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dru  Desulfotomaculum ruminis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:dru00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Desru_0163
Enzymes [BR:dru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Desru_0163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
158951..159808
Genome map
AA seq 285 aa AA seqDB search
MGLSLLAHAKINLTLDVCSRRPDGYHEVEMIMQQIQLHDRLDFWPAEKDISLTSSGLAID
AGEDNLILRAARLLQKATGERKGAVIHLHKEIPVAAGLAGGSTDAAATLVGLNQLWSLQL
SRKQLMDLAVQLGADVPFCLAGGTMLARGIGEILEPLSPAPSFGVILVKPPFGVPTAKIY
QGLNLDRLGPRPDTAAMVQALAKGHLDELAGGLCNVLESVTLELFPQLQTIKEKLVQTGC
QGALMSGSGPTVFGLTRDKQRAGEIASKLGDLEGQVIITEMKRPE
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtggggttgagccttctggcccatgctaaaataaacctgaccctggatgtatgctcccgt
cgtccggatggttaccatgaagtggaaatgattatgcagcaaatccagcttcatgatcgt
ctggatttttggcccgcagaaaaggacatttctcttacttcatccggattggccatcgat
gccggggaagataacctgattctgcgggcggcccgcctgttacagaaagcaaccggagag
cgaaaaggcgcggtcatccacctacataaagagattccggtggcagccggactggccggt
ggttccaccgatgccgctgccactttggttggtcttaatcaactatggagtttacaactc
agccggaaacaattaatggatctggcggttcaactgggagcggacgtacccttttgcctg
gccggaggaaccatgttggcccgggggattggtgaaattctggagcctttgtctccggca
ccttcctttggagttattttggtaaagcccccctttggggttcctacggcaaagatctat
cagggactgaatttagaccgtcttggcccccggcccgatactgccgccatggttcaggcc
ctggccaaagggcatttggatgaactggccggagggttatgcaatgtattggaaagtgtt
accctggagcttttcccccaactgcaaacaattaaagagaagcttgtacagaccggttgc
caaggggctttaatgtccggcagcggcccgacggtcttcgggttaacccgggacaagcaa
cgggccggagaaattgcttcaaaattgggagacctggaaggtcaggttataattaccgag
atgaaaaggccggaataa

DBGET integrated database retrieval system