KEGG   Desulfotomaculum ruminis: Desru_0232Help
Entry
Desru_0232        CDS       T01518                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
dru  Desulfotomaculum ruminis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dru00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
227716..228909
Genome map
AA seq 397 aa AA seqDB search
MEITVKYIDNLEQARMEIDAVGSDRLGTQLMAPKAVHRVIKLTGLNLKQANIVKQEMLAK
GGDAAVSRGVVSSSVETTDVLLMGTVKQYRSFIGKLSMQPFGLAKLADRLTEVLHNLEVQ
EKYILDCRGKELEVGGRTLVMGILNATPDSFSDGGRYLDPAAALEQAHKMVEDGADLIDL
GGISTRPGHQEVPLEEELRRVLPVLEKLVQEIAVPISIDTWRAPTAKEALERGAHMINDQ
WALTGDPDLAGVVSHYRAPLVLMYNGRQAITGDVMIETMKVLGQGIERAEEAGIPRKNLI
LDPGIGFNKSYQQNLEVLRRLRELAVLGCPVLLGTSRKSVIAKTLHLPVDERVEGTVATA
ALGIACGANIVRVHDVKETVRVARMSDAILRGNPHEG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggaaataacagtgaaatacatagacaacctggagcaggccaggatggagatcgacgcg
gtgggcagcgaccggctggggacgcagttaatggcacccaaggcagtgcatagggtaatc
aagcttacgggcctaaacttaaaacaggccaacattgtaaagcaggagatgctggctaaa
ggcggggatgcggcggtttcccggggcgtggtcagttcttcggtggagaccaccgatgtg
ctgttgatgggtaccgtaaaacaataccggtcctttattggcaagctgagcatgcagcct
ttcggattggccaaactggcggatcgattgacggaagtactccataacctggaagtccaa
gagaagtatattttggactgccggggcaaagagctggaagtgggcggccggacgctggtg
atgggaattttaaatgccactcccgactccttttcggacggggggcgctatctggaccct
gcagcggctttggaacaagctcacaagatggtggaagacggggcggatctgattgacctg
gggggtatctccacccggcccggacaccaggaagtgccccttgaggaagagctgcgcagg
gtgctgccggtgctggagaagttggtacaggaaatcgccgttcccatcagtatcgatacc
tggcgtgccccaacggctaaggaagccttggagcggggggcccatatgattaatgaccag
tgggccttaaccggagatccggatttggccggcgtagtgtcccactaccgggcccccctg
gtactcatgtacaatggccgtcaggccataaccggagatgtgatgatagagaccatgaag
gttcttggacaaggtattgaaagggctgaggaagcgggaatacccaggaaaaacctcatc
cttgatccggggattggctttaacaaaagctatcagcaaaatcttgaggttttaagaaga
ctgcgggaactggctgttctgggctgtcctgttctcctggggacatcccgaaaatctgtg
attgccaaaaccctgcatctgcctgtggatgagcgggtggaaggaacggttgctacggcg
gccctggggattgcctgcggagccaacattgtccgggtgcacgatgtaaaagaaaccgtc
agggtggccaggatgagcgatgccattttaagggggaacccccatgagggataa

DBGET integrated database retrieval system