KEGG   Desulfotomaculum ruminis: Desru_0234Help
Entry
Desru_0234        CDS       T01518                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
dru  Desulfotomaculum ruminis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dru00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
229270..229773
Genome map
AA seq 167 aa AA seqDB search
MARVYIGLGSNLGDKQRYIQTALERLSRTPSIRFLRVASLYESEPWGNTQQNWYLNTVAE
LDTDLPPLELLEVLLTIEKQLGRIRQERWGPRTIDLDLLLYGQEEVNHPDLQVPHPRMTE
RAFVLVPLAELCPERFLGQQKAKDWAAQAGLDQKIKKQQSSFPLKQS
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggcacgggtatatattggcctgggcagcaacctgggtgacaaacaaaggtatatccaa
accgctctggaacgattatcccgaactccgagcattcgctttttacgggtcgcctccctc
tatgaatcggaaccctggggcaatacgcaacagaactggtatttgaatacggtggcggaa
ttggacaccgacctgccccctctggaacttctggaagtgctgttgaccattgaaaagcag
ttggggagaatccgccaggaaaggtggggaccccgaaccatcgacctggatttgctgctt
tacggacaggaagaagtgaatcatccggatttgcaagttccccatcctcggatgacggaa
agggcttttgtgctggttcctctggcagaactttgtccggagcggtttttgggccagcaa
aaagcgaaagattgggcggctcaggccggactggatcagaaaatcaaaaaacaacagtcc
tcttttccattaaaacagtcgtaa

DBGET integrated database retrieval system