KEGG   Desulfotomaculum ruminis: Desru_0234Help
Entry
Desru_0234        CDS       T01518                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
dru  Desulfotomaculum ruminis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Desru_0234
Enzymes [BR:dru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Desru_0234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
229270..229773
Genome map
AA seq 167 aa AA seqDB search
MARVYIGLGSNLGDKQRYIQTALERLSRTPSIRFLRVASLYESEPWGNTQQNWYLNTVAE
LDTDLPPLELLEVLLTIEKQLGRIRQERWGPRTIDLDLLLYGQEEVNHPDLQVPHPRMTE
RAFVLVPLAELCPERFLGQQKAKDWAAQAGLDQKIKKQQSSFPLKQS
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggcacgggtatatattggcctgggcagcaacctgggtgacaaacaaaggtatatccaa
accgctctggaacgattatcccgaactccgagcattcgctttttacgggtcgcctccctc
tatgaatcggaaccctggggcaatacgcaacagaactggtatttgaatacggtggcggaa
ttggacaccgacctgccccctctggaacttctggaagtgctgttgaccattgaaaagcag
ttggggagaatccgccaggaaaggtggggaccccgaaccatcgacctggatttgctgctt
tacggacaggaagaagtgaatcatccggatttgcaagttccccatcctcggatgacggaa
agggcttttgtgctggttcctctggcagaactttgtccggagcggtttttgggccagcaa
aaagcgaaagattgggcggctcaggccggactggatcagaaaatcaaaaaacaacagtcc
tcttttccattaaaacagtcgtaa

DBGET integrated database retrieval system