KEGG   Desulfotomaculum ruminis: Desru_0239Help
Entry
Desru_0239        CDS       T01518                                 

Definition
pantoate--beta-alanine ligase
Orthology
K01918  
pantoate--beta-alanine ligase [EC:6.3.2.1]
Organism
dru  Desulfotomaculum ruminis
Pathway
beta-Alanine metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:dru00410]
Metabolism; Metabolism of cofactors and vitamins; Pantothenate and CoA biosynthesis [PATH:dru00770]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
234411..235256
Genome map
AA seq 281 aa AA seqDB search
MRLCKTIEEIRSLINAVRAEGKTVGLVPTMGYLHQGHLSLVQEARRRCEVLVVSIFVNPT
QFGPHEDYQTYPRDLQRDAGLLAGAGVDAVFAPEAAEMYPAGFSSYVDVSGVSQCLCGAS
RPGHFRGVATVVSKLFNIVRPDMAFFGQKDFQQVLVIKRMVEDLNMSVQIIDVPIVREED
GLALSSRNVYLSPEERSAALVLHRSLNLALDLVRSGERDTNRLKERIIKEITSEPLADID
YVEIRSLPHLSGLAELSGRALLALAVRFGKTRLIDNVVLEA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgagactgtgcaaaaccattgaagaaatccgttcactgatcaatgccgtacgggcggag
ggaaaaaccgtgggcttggtgcccaccatgggctacctgcaccagggacatctgtccctg
gtgcaggaggccagacgccgctgcgaggttctggtggtcagtatttttgttaatcctact
caatttggaccccatgaggattaccaaacctatccccgggacctgcaaagggatgccggc
ctgctggccggtgccggggttgatgctgtttttgccccggaggcggcggagatgtatccc
gccggattcagcagctacgtggatgtcagcggcgtcagccaatgcctttgcggggcctca
aggccggggcatttccgaggtgtggccacggtggtaagcaaattatttaacatcgtacgt
ccggatatggctttttttggacaaaaggatttccagcaggtgctggttataaaacgaatg
gttgaagatttaaatatgagtgtccagatcattgatgtgcccattgttcgggaagaagac
ggtttggctctcagttcccgcaatgtttatctctcgccggaagaacgatccgccgccctg
gtactgcaccgcagtttaaatctggctctggatttggtacgctccggggagcgggatacc
aaccgcttaaaggagcggattatcaaagaaattacctcggaacccctggcggacattgat
tatgtggagatccgctccctgccccatttaagcggcttagcggaactttccggccgggct
ctgctggctctggccgtccgctttggcaagacccggctcattgacaatgttgttctggag
gcatag

DBGET integrated database retrieval system