KEGG   Desulfotomaculum ruminis: Desru_0273Help
Entry
Desru_0273        CDS       T01518                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
dru  Desulfotomaculum ruminis
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:dru00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Desru_0273
Enzymes [BR:dru01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Desru_0273
Amino acid related enzymes [BR:dru01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Desru_0273
Transfer RNA biogenesis [BR:dru03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Desru_0273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
277524..278972
Genome map
AA seq 482 aa AA seqDB search
MSVRVRFAPSPTGPLHIGGARSALFNWLFARHHGGQFVVRIEDTDLERSSRESEENILNA
LRWLGMDWDEGIQVGGPNAPYRQTERLEIYRGLARKLLEQGHAYPCYCSEEDLAAEREML
MAKGELPRYLGRCRELCPEDRAKLEAEGRRPVLRFRVPENKIVTVNDRVRGQVEFDCNGI
GDFIIMKSDNIPTYNFAVVVDDHHMEITHVVRAEEHLSNTPRQLLIYEALGWKTPEFAHI
SLILGKDRSKMSKRHGATSIEQYQQLGYLPEALVNFLGLLGWSPGGEEEIFTTQQMIELF
SLDKVSKSPAVFDLDKLNWLNGNYIRQCPVDRLAQMAIPYLKEAGYLQGEVGPEKLEWLT
QVVAIASKYISYMQEITLHVDIFFKDQVPPVDEEAKQVLTEEHIPLVMNTTIKLVEEAEE
LTEASVKALLKAVGKQTGLKGKMIFMPVRVALTGKIHGPELHQIIPIFGKERTIARLRAS
SR
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
ttgtctgtacgggtccggttcgccccgagtccaacggggcctttacatattggaggggcc
agatcagccctttttaactggctttttgcccggcaccacgggggtcaatttgtggtcaga
atagaagataccgatctggagagatcctccagggaatcggaagagaatattttaaatgcc
ctgcgttggctgggcatggactgggatgaaggcatccaggtaggaggacctaacgctccc
taccggcaaacggagcgattggaaatttacaggggtttagcccgcaaattgttggaacaa
gggcatgcctatccttgctattgcagtgaagaggatctggccgccgagcgggaaatgctg
atggctaaaggggagttgcccaggtacctgggacgctgccgggaactttgcccggaggac
cgggcaaagcttgaagcagagggcagaaggccggtcctccgttttagggtacccgaaaat
aaaattgttaccgttaatgaccgggttcggggtcaggtggaatttgactgcaacggcatc
ggagatttcattatcatgaaatccgacaatattcccacttataattttgctgtggtggtg
gatgaccaccatatggaaattacccacgtggtccgggcggaggaacatttgtccaatacg
ccaaggcagttgttaatctatgaagccctgggctggaaaacccctgagtttgcccatatt
tctcttatcctgggcaaggatcgctcaaagatgagtaagcgccacggggccacctccatt
gaacagtatcagcagttaggttatctgccggaggccctggttaactttctgggcttattg
ggatggtcgccgggtggagaggaagaaatttttaccacccaacaaatgattgaattgttt
tcactggataaagtatccaaaagcccggcggtatttgatttagataaactcaactggctg
aacggcaattacattcgccaatgtcccgttgaccggttggcgcaaatggccattccttat
ttaaaagaagcgggatatttgcaaggagaagttgggcctgaaaaactggaatggttaaca
caggtggtggccatcgccagcaaatatatctcttatatgcaggaaataaccctgcatgtt
gacatcttcttcaaagaccaggtgccgccggtggatgaagaggccaaacaagttcttaca
gaggaacatattcctttggttatgaatacaactattaaactggtagaagaagcggaggag
cttaccgaagcgtcggtcaaggctttattaaaagccgttggcaagcaaaccggcctgaag
gggaaaatgatctttatgcctgtacgggttgcccttaccggaaaaattcacggaccggaa
ctgcaccagatcataccaatcttcgggaaagaacgtaccattgcccggttgagggcgtct
agtcgttag

DBGET integrated database retrieval system