KEGG   Desulfotomaculum ruminis: Desru_0432Help
Entry
Desru_0432        CDS       T01518                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dru  Desulfotomaculum ruminis
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:dru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Desru_0432
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Desru_0432
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Desru_0432
Enzymes [BR:dru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Desru_0432
Exosome [BR:dru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desru_0432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
436414..437907
Genome map
AA seq 497 aa AA seqDB search
MNKWFRNWQAAVAVLVTIAVLGIFMAGSPSRGIADSVKGGESYTGKTPKYIFMFVGDGMS
YPQVSSAEMFLGQQAMPGKITPKQLNFTRFPTHGALMTQDSSSFIPDSASTATSLASGHK
TLSGVINMDETKTKEYRPITEDLKAKGYKIGIITSVPITHATPAAFYAKVASRNDAYDIG
QQLAASGFDFFGGGSFDQPTGPEKDQPHIFEVVKNAGYKVVNNKDEILALNSESGKVVAI
NPELDGTAMDYEIDRQAGELSLADFVQKGIDVLDNPKGFFMMVESGKIDWAGHANDAAAS
IHDTIAFGDAIQKALEFYKKHPNETLILVTADHECGGMTIGFANTEYDTFFNKLQPVTMS
FVDFGKIFDQYRKTVTRDTAKLEDLQDEIKAGYGLTMADLSDYEIGLLRKALDWSMIPTE
ERKYTDQEKILYGTYEPFTVTLCHIINNKAGLSYTSYSHTGVPVPVYALGLGDELFDGFY
DNTEIYYKLAAVTNIKN
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
ttgaataaatggtttagaaactggcaggcagcggttgccgtactggtgaccatagccgta
ctggggatcttcatggcaggttcaccttctcgtggaatcgctgattctgttaaaggcggt
gagtcctatactggaaaaactccaaagtatatctttatgtttgtgggcgacggtatgagt
tatcctcaggttagtagtgcagagatgtttctggggcagcaagccatgccaggaaaaatt
actcctaagcagctcaattttacccggtttcctacccatggagccctgatgacccaagat
tcctcatcatttattccggattccgcttccacagcgacctccctggcttcgggtcacaag
actctttccggtgtaattaacatggatgaaacaaaaacaaaagaataccgtcctattacc
gaagatttaaaagcaaaaggctataagattggcatcatcaccagtgttcccatcactcat
gcaacccccgccgccttttacgccaaggttgccagcaggaatgatgcctatgatattgga
cagcagttggcagccagtggattcgatttctttggaggcggttcattcgatcagcccaca
ggacccgaaaaagatcagccgcatatttttgaggttgttaagaacgccggttataaagtc
gtaaataacaaggacgagatattggctttaaacagcgagtccggcaaagtagtggccatc
aatccggagttagatggaacggccatggactatgagattgaccgccaagcgggggaactc
tccctggccgattttgttcagaaaggcatcgatgtattagataatcccaagggatttttc
atgatggtcgaaagtgggaaaatcgactgggccggccatgctaatgacgcagccgcctcc
atccatgataccattgcttttggtgatgcaatccagaaagctttggaattctataagaaa
caccctaatgaaacactgattctggttactgccgaccatgagtgcggtggaatgaccatc
gggtttgcgaataccgagtatgataccttttttaataagcttcagcctgtaaccatgtcc
tttgtggattttggcaagatttttgaccaatacaggaaaaccgtaacccgcgataccgca
aaactagaggatttacaggacgaaattaaagccggatatggtctaaccatggcagatctg
agtgactacgaaattggcttgctgcggaaagctctggattggtccatgattccaacagaa
gagagaaaatacaccgatcaggaaaaaattctttatggcacttatgagccctttactgta
accctctgccatattataaacaacaaggccggactcagctataccagttattcccatacc
ggtgttcccgtaccggtttatgccctgggtctgggtgacgagttgtttgatggtttttat
gataacacagaaatttactacaagctggctgccgttaccaacattaaaaactga

DBGET integrated database retrieval system