KEGG   Desulfotomaculum ruminis: Desru_0761Help
Entry
Desru_0761        CDS       T01518                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dru  Desulfotomaculum ruminis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dru01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dru00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dru00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dru00640]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:dru00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:dru00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
774911..776848
Genome map
AA seq 645 aa AA seqDB search
MAVEKVHECAQEEQVYHPSLSFSARANVRDARIYDWAGMDYQSFWASEAEKLHWIKPWEK
VLEWQSPFAQWFVGGKLNACYNCVDRHLDGWRKNKAAIIFEGEPGDQMVLTYQDLYREVT
KFANVLRGMGIQKGDTVSIYMPMIPQAVIAMLACARIGVPHSLVFGGFSSEALRDRINDA
ASKVVVTTDACWRRGKAIPLKQSVDVALQSCSSVEKVVVVQRTGMEVAMEPGRDLWYHEL
MESARAGCEPEVMDAEDILFILYTSGTTGKPKGIVHTTGGYLTGVSSTHRNIFDLKEEDV
YWCTADIGWITGHSYIVYGPLANGSTVLMFEGAPDYPEKDRFWEIIEKYQVSIFYTAPTA
IRMFMKWGEQWPAGRDLSSLRLLGSVGEPINPEAWSWYHRNIGRENCPIVDTWWQTETGS
VMVAPLPGLTPTKAGSATLPLPGVFVDVVDESGNPVGAGGNGYLVIKQPWPSMLRTIYKD
PQRYVDTYWSHFDGMYFTGDGARRDEDGYIWVLGRVDDVINVSGHRIGTAEVESALVEHP
TVAEAAVIGRYHELKGQAVSAFVTLREGIAWSPELERDLKTHVAKKIGGLARPEEIVCAW
ELPKTRSGKIMRRLLRDIAEGRVLGDTSTLADPSVVSQLMKQKTL
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgaaaaagttcatgagtgtgctcaggaggagcaagtttatcatccctcttta
tccttttccgcccgggccaatgtccgggatgcccggatttatgactgggccggcatggat
tatcaaagcttctgggcttcagaagcggaaaaactgcactggatcaagccctgggaaaag
gtgctggagtggcagagtccctttgcccagtggttcgtcggaggcaagctgaatgcttgt
tataattgtgtggaccgccacttggacggctggcgtaaaaataaagcggccattatcttt
gaaggtgaaccgggcgatcagatggttttaacttatcaggatctgtaccgggaagtaact
aaatttgccaatgtactgcggggcatgggaatccaaaagggcgatacggtcagtatttac
atgcccatgattccccaggcggtgattgccatgctggcctgcgcccgtatcggcgtgcct
cacagtctggtatttggaggcttttcttccgaagccttgcgggaccggattaatgacgcg
gcctccaaggttgtcgttacaaccgatgcctgctggcgccggggcaaggctattcctttg
aagcagagcgtggatgtggctttacaaagctgctccagcgtagagaaggttgtggtggtt
cagcgaaccggcatggaagttgccatggaaccgggccgagatctctggtaccatgaattg
atggagagcgcacgggcaggctgtgagcccgaagtgatggatgccgaagatattcttttt
attctctacaccagcggcaccaccggaaaacccaaaggcattgtgcatacaaccgggggt
tacttaaccggagtttcttccacccaccgcaatatttttgaccttaaggaagaagacgta
tattggtgcacggcggatatcggctggattaccggacacagctacattgtttacggacct
ctggccaacggcagtaccgttttgatgtttgaaggggcaccggactaccctgagaaggat
cgtttctgggaaatcatagaaaagtaccaggtcagcattttttacacggctcccacggcc
atccgtatgttcatgaagtggggagagcagtggcccgccggcagagatttatcctctctg
cgtttactgggttcggtgggcgagcccattaaccccgaggcctggtcctggtatcataga
aatatcggcagagaaaattgtcccattgtggatacctggtggcagacggagaccggtagt
gtgatggttgctcccctgccgggcttaactcccaccaaagccggatccgccaccctgcct
ttgcccggcgtattcgtggatgtagtggatgaatcaggcaacccggtgggagccggcggc
aacggctatctggtgatcaagcagccctggccctccatgctgcggaccatttacaaggat
ccccagcgttatgtggatacctactggtcccatttcgacggtatgtattttaccggcgac
ggcgctcgccgggatgaagacggctatatttgggtgctggggcgggtggatgatgtaatt
aatgtttccggtcacagaatcggtacggccgaagtggaaagtgccctggttgaacatccc
acggtggctgaagcggctgttatcgggcgctaccatgaattaaagggtcaggcggtttcc
gcctttgttaccctgagggaaggaattgcctggtctcctgaactggaaagggatttaaag
acccacgtggccaaaaagattggcggcctggccaggccggaggaaattgtctgtgcctgg
gaattgccgaaaacccgcagcggtaaaattatgcggcgcttactcagggatattgccgag
ggcagggtgctgggcgacacttcaaccttagcggacccttcggtggttagccaattgatg
aaacaaaaaaccctgtaa

DBGET integrated database retrieval system