KEGG   Desulfotomaculum ruminis: Desru_0761Help
Entry
Desru_0761        CDS       T01518                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dru  Desulfotomaculum ruminis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desru_0761
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desru_0761
   00620 Pyruvate metabolism
    Desru_0761
   00640 Propanoate metabolism
    Desru_0761
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desru_0761
   00680 Methane metabolism
    Desru_0761
Enzymes [BR:dru01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Desru_0761
Lipid biosynthesis proteins [BR:dru01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Desru_0761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
774911..776848
Genome map
AA seq 645 aa AA seqDB search
MAVEKVHECAQEEQVYHPSLSFSARANVRDARIYDWAGMDYQSFWASEAEKLHWIKPWEK
VLEWQSPFAQWFVGGKLNACYNCVDRHLDGWRKNKAAIIFEGEPGDQMVLTYQDLYREVT
KFANVLRGMGIQKGDTVSIYMPMIPQAVIAMLACARIGVPHSLVFGGFSSEALRDRINDA
ASKVVVTTDACWRRGKAIPLKQSVDVALQSCSSVEKVVVVQRTGMEVAMEPGRDLWYHEL
MESARAGCEPEVMDAEDILFILYTSGTTGKPKGIVHTTGGYLTGVSSTHRNIFDLKEEDV
YWCTADIGWITGHSYIVYGPLANGSTVLMFEGAPDYPEKDRFWEIIEKYQVSIFYTAPTA
IRMFMKWGEQWPAGRDLSSLRLLGSVGEPINPEAWSWYHRNIGRENCPIVDTWWQTETGS
VMVAPLPGLTPTKAGSATLPLPGVFVDVVDESGNPVGAGGNGYLVIKQPWPSMLRTIYKD
PQRYVDTYWSHFDGMYFTGDGARRDEDGYIWVLGRVDDVINVSGHRIGTAEVESALVEHP
TVAEAAVIGRYHELKGQAVSAFVTLREGIAWSPELERDLKTHVAKKIGGLARPEEIVCAW
ELPKTRSGKIMRRLLRDIAEGRVLGDTSTLADPSVVSQLMKQKTL
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgaaaaagttcatgagtgtgctcaggaggagcaagtttatcatccctcttta
tccttttccgcccgggccaatgtccgggatgcccggatttatgactgggccggcatggat
tatcaaagcttctgggcttcagaagcggaaaaactgcactggatcaagccctgggaaaag
gtgctggagtggcagagtccctttgcccagtggttcgtcggaggcaagctgaatgcttgt
tataattgtgtggaccgccacttggacggctggcgtaaaaataaagcggccattatcttt
gaaggtgaaccgggcgatcagatggttttaacttatcaggatctgtaccgggaagtaact
aaatttgccaatgtactgcggggcatgggaatccaaaagggcgatacggtcagtatttac
atgcccatgattccccaggcggtgattgccatgctggcctgcgcccgtatcggcgtgcct
cacagtctggtatttggaggcttttcttccgaagccttgcgggaccggattaatgacgcg
gcctccaaggttgtcgttacaaccgatgcctgctggcgccggggcaaggctattcctttg
aagcagagcgtggatgtggctttacaaagctgctccagcgtagagaaggttgtggtggtt
cagcgaaccggcatggaagttgccatggaaccgggccgagatctctggtaccatgaattg
atggagagcgcacgggcaggctgtgagcccgaagtgatggatgccgaagatattcttttt
attctctacaccagcggcaccaccggaaaacccaaaggcattgtgcatacaaccgggggt
tacttaaccggagtttcttccacccaccgcaatatttttgaccttaaggaagaagacgta
tattggtgcacggcggatatcggctggattaccggacacagctacattgtttacggacct
ctggccaacggcagtaccgttttgatgtttgaaggggcaccggactaccctgagaaggat
cgtttctgggaaatcatagaaaagtaccaggtcagcattttttacacggctcccacggcc
atccgtatgttcatgaagtggggagagcagtggcccgccggcagagatttatcctctctg
cgtttactgggttcggtgggcgagcccattaaccccgaggcctggtcctggtatcataga
aatatcggcagagaaaattgtcccattgtggatacctggtggcagacggagaccggtagt
gtgatggttgctcccctgccgggcttaactcccaccaaagccggatccgccaccctgcct
ttgcccggcgtattcgtggatgtagtggatgaatcaggcaacccggtgggagccggcggc
aacggctatctggtgatcaagcagccctggccctccatgctgcggaccatttacaaggat
ccccagcgttatgtggatacctactggtcccatttcgacggtatgtattttaccggcgac
ggcgctcgccgggatgaagacggctatatttgggtgctggggcgggtggatgatgtaatt
aatgtttccggtcacagaatcggtacggccgaagtggaaagtgccctggttgaacatccc
acggtggctgaagcggctgttatcgggcgctaccatgaattaaagggtcaggcggtttcc
gcctttgttaccctgagggaaggaattgcctggtctcctgaactggaaagggatttaaag
acccacgtggccaaaaagattggcggcctggccaggccggaggaaattgtctgtgcctgg
gaattgccgaaaacccgcagcggtaaaattatgcggcgcttactcagggatattgccgag
ggcagggtgctgggcgacacttcaaccttagcggacccttcggtggttagccaattgatg
aaacaaaaaaccctgtaa

DBGET integrated database retrieval system