KEGG   Desulfotomaculum ruminis: Desru_0761Help
Entry
Desru_0761        CDS       T01518                                 

Definition
(RefSeq) acetate/CoA ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dru  Desulfotomaculum ruminis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desru_0761
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desru_0761
   00620 Pyruvate metabolism
    Desru_0761
   00640 Propanoate metabolism
    Desru_0761
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desru_0761
   00680 Methane metabolism
    Desru_0761
Enzymes [BR:dru01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Desru_0761
Lipid biosynthesis proteins [BR:dru01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Desru_0761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
774911..776848
Genome map
AA seq 645 aa AA seqDB search
MAVEKVHECAQEEQVYHPSLSFSARANVRDARIYDWAGMDYQSFWASEAEKLHWIKPWEK
VLEWQSPFAQWFVGGKLNACYNCVDRHLDGWRKNKAAIIFEGEPGDQMVLTYQDLYREVT
KFANVLRGMGIQKGDTVSIYMPMIPQAVIAMLACARIGVPHSLVFGGFSSEALRDRINDA
ASKVVVTTDACWRRGKAIPLKQSVDVALQSCSSVEKVVVVQRTGMEVAMEPGRDLWYHEL
MESARAGCEPEVMDAEDILFILYTSGTTGKPKGIVHTTGGYLTGVSSTHRNIFDLKEEDV
YWCTADIGWITGHSYIVYGPLANGSTVLMFEGAPDYPEKDRFWEIIEKYQVSIFYTAPTA
IRMFMKWGEQWPAGRDLSSLRLLGSVGEPINPEAWSWYHRNIGRENCPIVDTWWQTETGS
VMVAPLPGLTPTKAGSATLPLPGVFVDVVDESGNPVGAGGNGYLVIKQPWPSMLRTIYKD
PQRYVDTYWSHFDGMYFTGDGARRDEDGYIWVLGRVDDVINVSGHRIGTAEVESALVEHP
TVAEAAVIGRYHELKGQAVSAFVTLREGIAWSPELERDLKTHVAKKIGGLARPEEIVCAW
ELPKTRSGKIMRRLLRDIAEGRVLGDTSTLADPSVVSQLMKQKTL
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgaaaaagttcatgagtgtgctcaggaggagcaagtttatcatccctcttta
tccttttccgcccgggccaatgtccgggatgcccggatttatgactgggccggcatggat
tatcaaagcttctgggcttcagaagcggaaaaactgcactggatcaagccctgggaaaag
gtgctggagtggcagagtccctttgcccagtggttcgtcggaggcaagctgaatgcttgt
tataattgtgtggaccgccacttggacggctggcgtaaaaataaagcggccattatcttt
gaaggtgaaccgggcgatcagatggttttaacttatcaggatctgtaccgggaagtaact
aaatttgccaatgtactgcggggcatgggaatccaaaagggcgatacggtcagtatttac
atgcccatgattccccaggcggtgattgccatgctggcctgcgcccgtatcggcgtgcct
cacagtctggtatttggaggcttttcttccgaagccttgcgggaccggattaatgacgcg
gcctccaaggttgtcgttacaaccgatgcctgctggcgccggggcaaggctattcctttg
aagcagagcgtggatgtggctttacaaagctgctccagcgtagagaaggttgtggtggtt
cagcgaaccggcatggaagttgccatggaaccgggccgagatctctggtaccatgaattg
atggagagcgcacgggcaggctgtgagcccgaagtgatggatgccgaagatattcttttt
attctctacaccagcggcaccaccggaaaacccaaaggcattgtgcatacaaccgggggt
tacttaaccggagtttcttccacccaccgcaatatttttgaccttaaggaagaagacgta
tattggtgcacggcggatatcggctggattaccggacacagctacattgtttacggacct
ctggccaacggcagtaccgttttgatgtttgaaggggcaccggactaccctgagaaggat
cgtttctgggaaatcatagaaaagtaccaggtcagcattttttacacggctcccacggcc
atccgtatgttcatgaagtggggagagcagtggcccgccggcagagatttatcctctctg
cgtttactgggttcggtgggcgagcccattaaccccgaggcctggtcctggtatcataga
aatatcggcagagaaaattgtcccattgtggatacctggtggcagacggagaccggtagt
gtgatggttgctcccctgccgggcttaactcccaccaaagccggatccgccaccctgcct
ttgcccggcgtattcgtggatgtagtggatgaatcaggcaacccggtgggagccggcggc
aacggctatctggtgatcaagcagccctggccctccatgctgcggaccatttacaaggat
ccccagcgttatgtggatacctactggtcccatttcgacggtatgtattttaccggcgac
ggcgctcgccgggatgaagacggctatatttgggtgctggggcgggtggatgatgtaatt
aatgtttccggtcacagaatcggtacggccgaagtggaaagtgccctggttgaacatccc
acggtggctgaagcggctgttatcgggcgctaccatgaattaaagggtcaggcggtttcc
gcctttgttaccctgagggaaggaattgcctggtctcctgaactggaaagggatttaaag
acccacgtggccaaaaagattggcggcctggccaggccggaggaaattgtctgtgcctgg
gaattgccgaaaacccgcagcggtaaaattatgcggcgcttactcagggatattgccgag
ggcagggtgctgggcgacacttcaaccttagcggacccttcggtggttagccaattgatg
aaacaaaaaaccctgtaa

DBGET integrated database retrieval system