KEGG   Desulfotomaculum ruminis: Desru_1185Help
Entry
Desru_1185        CDS       T01518                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase
Organism
dru  Desulfotomaculum ruminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1220580..1221572
Genome map
AA seq 330 aa AA seqDB search
MNFKKVSLVSMERTPLQFLPRLSRHLGGPRIYIKREDMNGCLGLAGNKIRKLEYLLAEAL
EQGCDTVITTGGLQSNHARATVAACRKLDLKPVLVLVGKAPEGFLSGNLLLGHLMGAEMV
FTGSGDFSLLEAKVAETAEKLAARGHRPYVIPMGASNPLGTLGFVAAQRELGEQLREEAV
APTWQVATAGSGGTYAGILLGALLEQQANRVLGFSVLFPVEEISHKIKELALAASHLLKG
NMAEEKIQKEIRIDSHYIGAGYGIPTEEGLKAIKLLAELEGILLDPTYTGKAMAGLLDYI
QKGIIGPKDTVVFWHTGGQVGLFNRPLFKI
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaattttaaaaaggtttcactggtttccatggagcggacgccgctgcagtttttgccc
aggctgagccggcatctgggcggtccccggatttatatcaaacgggaggatatgaacggt
tgcctggggctggccggaaacaaaatccgcaagcttgaatacctgctggcagaggctttg
gagcagggatgcgatacggtgattaccaccgggggcttacagtctaatcacgccagggcc
accgtggcagcctgccgcaaactggacctcaaaccggtattggttctggtggggaaagca
ccggagggatttctttccggcaacctgctgctgggtcatttaatgggtgcggaaatggta
tttaccggaagcggcgattttagcctgctagaagcgaaagtggctgagacagcggaaaaa
ttagcagcccggggtcatcgaccctatgtcattcccatgggcgcttccaacccgctgggc
accttaggctttgtggcagcccaaagggaactaggggaacagttaagggaagaggccgtt
gcacccacctggcaggtggcaacggccggctccggcggtacctacgccggaattctgctg
ggagccctgctggagcagcaggctaaccgggtactgggattttccgtattgtttccggtg
gaggaaatcagccataaaataaaagaactggccctggcagccagtcatttattaaaaggg
aatatggccgaagaaaaaatccaaaaggaaattcgtattgacagccactatatcggggcc
ggttacggcattcccaccgaagaaggcctaaaggccatcaagctgttggcggaactggag
gggattcttttggatcccacctatacgggaaaagccatggccgggctgctggattatatt
caaaaaggaatcatcggcccgaaagacaccgttgttttttggcataccggcgggcaggta
ggactgttcaaccggcctttgtttaaaatctag

DBGET integrated database retrieval system