KEGG   Desulfotomaculum ruminis: Desru_1208Help
Entry
Desru_1208        CDS       T01518                                 

Definition
CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
dru  Desulfotomaculum ruminis
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dru00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Desru_1208
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Desru_1208
Enzymes [BR:dru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Desru_1208
Two-component system [BR:dru02022]
 CheA family
  CheA-CheYBV
   Desru_1208
Bacterial motility proteins [BR:dru02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Desru_1208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1242277..1243362
Genome map
AA seq 361 aa AA seqDB search
MQVKVLVVDDSSLMRRLISRLLEEDKEIKVIGTAADGLEALQQIKALKPDVVSMDVEMPK
LDGIATLRRVMRECPVPIVMLSAHTHEGARATMEALSAGAVDFVPKPSKSTELPVMVADL
KTKLKVAARVSMRRVARPVLPPRSTISRETAPPAPPKVPALPIRKQRNCAKIDLVVIGCS
TGGPAALQQIIPFLPANLPAGVVVVQHIPVGFSKSMAEHLDKKSGITVRHAEEGDEVKPG
LVLVSPAGYDLSFKAKGSGTAITLSNQGAPLAPGGFRPSVDWVMKSAAEVYGCRAMGVLL
TGMGRDGAQGMLAIKQQGGPTMAEHESTCVVYGMPKAAVDLGAAQKIVPLTQMAQEIQSI
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttaaagtcctggtggttgacgattcttcccttatgaggcggctgatcagccgc
cttttggaggaagataaagagatcaaggtcattggcaccgctgcggacggtctggaagcc
ctgcagcagattaaggccttgaagcccgacgtagtctccatggatgtagaaatgcctaaa
ttggacggaattgctaccctgcgccgggttatgcgggagtgtccggtgcccattgtgatg
ttgagcgcccacacccatgagggggcccgggccaccatggaagccctgtccgccggagcg
gtggactttgtgcccaaaccgagcaaatccactgaactgccggtgatggtagcggatctg
aaaaccaaactcaaagtggctgccagggtatccatgcgccgggtagcccgtcctgtactg
ccgcccaggtccacaatttcccgggaaaccgctccgccggctcctcccaaagtcccggcg
cttccgatcaggaaacaacgcaactgcgctaaaatcgatttggtggtgatcggctgttcc
accggcggtccggcggcgcttcagcaaattatcccttttttgcctgccaatttgcctgcc
ggtgtggtggttgttcagcacatcccggtgggtttttctaaatccatggcggaacatttg
gataaaaagagcggcattaccgtgcgtcatgccgaagaaggggatgaagtgaaacccggc
ctggtgctggtctctcctgcagggtatgatttaagtttcaaagcaaaggggagcggtacg
gccattaccctcagcaatcaaggggcgcctttggccccgggcggtttccgtccttcggtg
gattgggtgatgaagtccgccgccgaggtttacggctgccgggccatgggcgtactgctg
acaggcatgggacgggacggcgcccagggcatgctggccattaaacaacagggcgggccc
accatggcggaacacgaaagcacctgcgtagtttatggcatgcctaaggcagccgtggat
ctgggggcggctcaaaaaattgtgcccctgacccagatggcccaggaaatccagtcaatt
ttctaa

DBGET integrated database retrieval system