KEGG   Desulfotomaculum ruminis: Desru_1354Help
Entry
Desru_1354        CDS       T01518                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dru  Desulfotomaculum ruminis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desru_1354
   01230 Biosynthesis of amino acids
    Desru_1354
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desru_1354
   00030 Pentose phosphate pathway
    Desru_1354
   00051 Fructose and mannose metabolism
    Desru_1354
   00052 Galactose metabolism
    Desru_1354
  Energy metabolism
   00680 Methane metabolism
    Desru_1354
Enzymes [BR:dru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Desru_1354
Protein phosphatases and associated proteins [BR:dru01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Desru_1354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1373120..1374082
Genome map
AA seq 320 aa AA seqDB search
MQRIGVLTSGGDAPGMNSCIRAVVRKAIYHGMEVIGIKRGYSGFIDADMGPMNLGSVADI
IHRGGTILHTARSQRFQTKEGRAQAMENVRRFGIQGLVVIGGDGSFTGASIFHQEHGIPV
VGVPGTIDNDISGTDYTIGFDTALNNVVDAINKIRDTATSHERTFVIEVMGRNSGNIALA
AGLAGGAESILVPEILFNIEDICHKLLSGHKRGKLHSIILVAEGAASGLTIGQQIKDLTG
FDTKVTILGHLQRGGIPSAFDRILAARLGAKAVELLMAGDSGKMVGVRSGEVVASDLQEI
LGKPCPINDEMYQLAKILSI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcagagaataggcgtcttaaccagcggcggagatgcgccgggaatgaattcctgcatt
cgggcagtggttcgcaaggccatctatcatggcatggaagtgattggaattaaacgggga
tacagtggttttattgatgccgatatgggtcccatgaatcttggctcagtggcggatatt
atccaccggggaggaaccattttacatacggcccggtcccagcgcttccagaccaaggaa
ggccgcgctcaggccatggagaacgtccggcgctttggcattcagggattggtggtcatc
ggcggggacggttcttttaccggcgccagcatctttcatcaggaacacggaattccggtg
gtgggggttcccgggaccattgacaatgatatcagcggtacggattataccattggtttt
gatacagccctaaacaatgtagtggatgccattaataaaatccgggatacggccacctcc
catgaaagaacctttgtcattgaggttatgggtcgaaattcgggcaatattgccctggcc
gccgggctggccggcggggccgaaagcatcctggttcctgaaattctctttaatattgaa
gacatttgccataagctgttaagcggacataaacggggtaaactacactccatcatcctg
gttgccgaaggagctgccagcggtttaaccattggccaacaaattaaggatttgaccggc
tttgataccaaagtaaccattctgggccatctgcagcggggcggtattccttccgccttt
gaccggattttggcagcccggctgggagcaaaggccgtagagcttttaatggccggggat
agcggcaaaatggttggcgtccgctccggagaagtggttgcctcggatttgcaggaaata
ctggggaaaccctgccccatcaatgacgagatgtaccaactggccaaaatactttcaatt
tag

DBGET integrated database retrieval system