KEGG   Desulfotomaculum ruminis: Desru_1362Help
Entry
Desru_1362        CDS       T01518                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dru  Desulfotomaculum ruminis
Pathway
dru00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dru01100  Metabolic pathways
dru01110  Biosynthesis of secondary metabolites
dru01130  Biosynthesis of antibiotics
dru01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dru00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desru_1362
Enzymes [BR:dru01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Desru_1362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh QRPTase_C His_biosynth
Motif
Other DBs
NCBI-ProteinID: AEG59635
JGI: Desru_1362
UniProt: F6DPQ8
Position
1381329..1382126
Genome map
AA seq 265 aa AA seqDB search
MILDRILEVKRSEVQGLLERFRVSEMAREAAQLPPARDFRRAIDQPGRVSLIAEIKKQSP
SKGLLCRFFDPCRLARIYRDHGAAAVSVLTDRTFFGGKGEYLAQVRQEVDLPLLRKDFIL
DPVQIYESRLLGADAVLLIVAALSRESLSRLLELCREVGLQALVEVHSEEELERAIKAGA
DLIGINNRNLQTFETELQTTLRLMEVVKESGITVVSESGIHHFRDMSLLKAVGVQAALVG
EALVTAPDIGLKVQELAKGGGALAL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
ttgatattggaccgcatattggaagtcaaaagaagcgaagttcaagggctgctggaacgg
ttccgggtttccgagatggcccgggaagcggctcagttgccccccgccagggattttcgc
cgggccattgatcagcccggcagggtttctctgattgccgaaataaaaaaacaatctccc
tccaagggcctcctgtgccggttctttgatccttgccgcctggcccggatttaccgggat
catggagcggcagccgtctccgtcctgacggatcggacttttttcggcggtaaaggggag
tatttggcccaggttcggcaggaagtggatctgcccctgctgcgcaaggattttatcctt
gacccggtgcaaatctatgagagccggctgcttggcgccgatgcggtgctgctcatcgtg
gcggcgctttcccgggaaagtctgtcccggctgctggagctctgccgggaagtgggtctt
caggcgctggtggaggtacacagcgaggaagaactggaacgagccataaaagccggggcg
gatttgatcggcattaacaaccggaatctgcagacctttgaaacagaattgcaaactacc
ctgcggctaatggaagtagttaaagaatccggtataaccgttgtcagtgagagcggcatt
catcactttagggacatgagcctgctgaaggccgtgggggtccaggctgccctggtgggt
gaggcccttgttacggcgccggatatcggtcttaaagtgcaggaactggcgaaggggggc
ggagcccttgccttataa

DBGET integrated database retrieval system