KEGG   Desulfotomaculum ruminis: Desru_1364Help
Entry
Desru_1364        CDS       T01518                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dru  Desulfotomaculum ruminis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dru00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desru_1364
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desru_1364
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desru_1364
Enzymes [BR:dru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desru_1364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1382738..1383928
Genome map
AA seq 396 aa AA seqDB search
MQPDNRGYFGSYGGIFVPETLIPALEELTKAYQQAQQDGNFQREVEHYLKNYVGRPSPVY
LARGLSEKMGGARIWLKREDLNHTGAHKINNTLGQVLLARRMGKKRIIAETGAGQHGVAT
ATAAAMFGLQCVVYMGEEDIRRQSLNVFRMKLLGAEVVEVSSGTGTLKDAMNEAMRDWVT
NVRNTYYIIGSVAGPHPYPMMVRDFQKIIGQEAREQMLEQSGGLPHCVVACVGGGSNAMG
AFYAFLEDREVELVGVEAGGLGLDTDRHAAPLTAGRPGVLHGSYSYLIQDGDGQVTPVHS
VSAGLDYPGVGPEHSYLKDTGRVSYTVATDREALNAFHLLCRTEGIIPALESAHALAEAI
KRAARMSKERSILVCLSGRGDKDVHTVAKEMGVDLA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcagccggataacaggggatattttggttcctacggaggaatttttgtaccagaaacg
ctcatcccggccctggaggaactgacaaaggcctaccagcaggcgcagcaggatggcaat
tttcaacgggaagtggaacattacctgaaaaattatgtgggccgtccctccccggtgtat
cttgcccggggcttaagcgaaaaaatggggggagcccggatttggttaaaacgggaagat
ttaaatcacaccggggcccacaagattaacaataccctgggacaggtgctgctggccagg
cgtatgggcaaaaagcggattattgccgaaacaggagcgggtcagcacggcgtggccacc
gccaccgccgccgccatgttcgggctgcagtgtgtggtgtatatgggagaggaggacatc
cgccgccaatccctcaatgtgtttcgcatgaagctgctgggggcggaagtggttgaagtg
tcctcgggaaccggaaccctgaaggatgccatgaatgaggccatgcgggactgggttacc
aatgtccggaacacctattatattattggttcggtggcgggtccccatccctatcccatg
atggtcagggattttcagaaaatcatcggccaggaggcccgggagcagatgctggagcaa
agcggaggcctgccccactgcgtagtggcctgtgttggaggcggcagcaatgccatgggg
gctttctatgcctttctggaggatcgggaggtagaactggtgggggttgaggccgggggc
ttgggactggataccgaccggcacgccgcgccgcttacggcaggtcgtccgggtgtgctg
cacggttcctacagctatttaattcaagatggggacggccaggttacgccggttcattcg
gtttccgcaggtttggattatcccggagtgggaccggagcacagttatctcaaagatacc
ggccgggtttcctataccgtggccaccgaccgggaggccctgaatgcctttcatttatta
tgccgaaccgaggggattattcccgccctggaaagcgcccacgccctggcggaggcgatt
aagcgagccgctcgcatgagcaaggagcgaagtatcctggtttgcttatcaggccggggt
gacaaggatgttcataccgtggccaaagaaatgggggtggatctggcatga

DBGET integrated database retrieval system