KEGG   Desulfotomaculum ruminis: Desru_1387Help
Entry
Desru_1387        CDS       T01518                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dru  Desulfotomaculum ruminis
Pathway
dru00030  Pentose phosphate pathway
dru01100  Metabolic pathways
dru01120  Microbial metabolism in diverse environments
dru01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dru00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Desru_1387
Enzymes [BR:dru01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Desru_1387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AEG59659
JGI: Desru_1387
UniProt: F6DQ81
Position
1405486..1407216
Genome map
AA seq 576 aa AA seqDB search
MPRFLRIDMKKGTAEFQDVPEKYLALGGRALTSQMVSDEVPATCNPLGERNKLIIAPGLL
SGTNAPSSGRLSVGGKSPLTGGIKEANAGGICAQKLANLDIKAMIVEGKPAEKGAWMVKV
SPEGAEVLKADDLVGKGTYEVTAILRERYGSKVGVICIGPAGEYMLMGAGVATNDAEGNS
SRYAGRGGLGAVMGSKGLKAIVIDSPNTFDVPVQDKERFSAAAKKFAKILLEHPVTGSGL
PNFGTNVLMNIISEAGTLPVKNFGNNGRFDKANEVSGERLAEVAKARGGKATHVCHPGCV
MRCSNVYPMPDGKVCSPIEYETAWCFGPNLGISDLDVVAKLNYICNDAGLDTIEMGVALG
VLMEAGVIPFGDADAAVAALEEVAKGTPAGRILGNGAVFVGKAYGITRVAAVKGQSIPAY
DPRSCKGNGVTYATSPMGGDHTAGYAVTANILKVGGFVDPTKAEGQVELSRNLQIATAAV
DATGLCLFVAFAVLDNPEGLPTIVEMLNAQYGLSLEVDDVVTLGQNILKTERAFNAAAGL
SSVDDRLPEFFYTDKLAPHNTVFDIKDEELDTVFNF
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgccaaggtttttaagaatcgacatgaaaaaggggacagccgaatttcaggatgtgccg
gaaaagtatttggcactgggcggccgggcactcacctcgcagatggtctcggatgaagta
cccgcaacctgcaatccgctgggggaacgaaacaaattaattattgccccgggcctgctg
tccggaaccaacgcaccctcttccggacgcttgtctgtaggcggcaaaagccctctgaca
ggcggcatcaaagaagccaatgccggcggcatttgcgctcagaaactggccaacctggat
attaaggccatgattgtcgaaggcaagccggcggagaaaggcgcctggatggtgaaggtt
tcgccggaaggagcagaggttttaaaggccgatgatttggtgggcaaaggcacctatgaa
gtaacggccatcctccgtgagcgttacggcagcaaagttggcgtaatctgcattggacct
gccggagaatacatgctgatgggcgccggtgtagccaccaatgatgccgaaggaaactcc
agccggtatgccggccgtggcggcttgggcgcggtcatgggctccaaagggctgaaggcc
atcgttattgattctcccaatacttttgacgtgccggttcaggataaggagcgcttctct
gcggcggccaagaaatttgccaagattttgctggaacacccggttaccggttccggtctg
cccaatttcggcaccaatgttctgatgaacattatcagcgaagcgggcactctccccgtt
aagaattttggaaataacgggcgttttgacaaagccaatgaggtcagcggcgagcgtctg
gctgaggttgccaaggcccgcggcggcaaagccactcatgtctgccatcccggttgtgtc
atgcgctgctccaacgtttatcccatgcccgacggcaaggtttgctctcccatcgagtat
gaaaccgcctggtgctttggacccaacctgggaatcagcgatctggatgttgtggctaaa
ctgaactacatttgcaacgatgccggcctggacaccattgaaatgggcgttgccctgggg
gttctgatggaagccggcgttattcccttcggcgatgcggatgccgccgtggcggccctg
gaagaagtggccaagggaactcctgcgggccgtatcctgggcaatggcgcggtctttgtg
ggtaaagcatacggcattacccgggtcgcggctgttaaaggccaaagcattcctgcttac
gatcccaggtcctgcaaagggaatggtgttacctatgccaccagccccatgggtggcgat
cacacggccggttatgctgtaaccgccaacatccttaaagtgggtggctttgttgacccg
accaaagcggaagggcaggttgaactatcccggaatctgcagattgccaccgcggccgta
gatgccaccggcttgtgcctgttcgtggcctttgccgttttggacaatccggaaggtttg
cctaccattgtggaaatgctgaatgcccaatatggtcttagtttggaagttgacgacgtg
gtaactttgggtcagaacattttgaagaccgagcgtgcttttaatgccgccgccggatta
agcagtgtggacgatcgtctgcctgaatttttctataccgacaagctggctcctcacaat
accgtatttgatatcaaggacgaagaattagacacggtatttaatttctag

DBGET integrated database retrieval system