KEGG   Desulfotomaculum ruminis: Desru_1440Help
Entry
Desru_1440        CDS       T01518                                 

Definition
(RefSeq) AMP-dependent synthetase and ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dru  Desulfotomaculum ruminis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desru_1440
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desru_1440
   00620 Pyruvate metabolism
    Desru_1440
   00640 Propanoate metabolism
    Desru_1440
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desru_1440
   00680 Methane metabolism
    Desru_1440
Enzymes [BR:dru01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Desru_1440
Lipid biosynthesis proteins [BR:dru01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Desru_1440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1466839..1468521
Genome map
AA seq 560 aa AA seqDB search
MIMYEKYIGRHRDEFVTLEDLYKNYSIDCPDDFNFAYDVLDVLAEKKPDKLAMLWVGKDG
SEKRITFGDMKRWSNKTANYFKALGIKKGDFVLLVLKRSYLFWYAMLALHKIGAVAVQAT
HLLTAKDYVYRCQAAGIKMAVITGDGDCTRDFDKAAPECNTVELKAVTGHKAAGEGWLDF
EAGIEAAPDHWQRPTGEEATKVTDILITAFSSGTTGYPKMVAHDHSYPLGHIITGVFWHR
AEPDGLHFTISDTGWLKSLWGKFYGQWFAESAVFTYDFDSFKGADILEKLAKYRITTFCA
PPTMYRFMLKEDVGTYDLSALKHCCTAGEALNPEVYNQWKRATGLRIFEGFGQTETTLSC
STLYPWVQPRPGSMGLPTPGYGLVIVDENGREVDPGVTGEICLKADSMETRTKGIFMGYY
RDEMSTQKAWHDGLYHTGDTAYRDELGFLWYVGRNDDIIKSSGYRIGPFEVESALAEHPA
VLESAVTGIPDPIRGFVVKATIVLSKGYEPCEELVKELQEHVKKTTAPYKYPRVVEFVAE
LPKTISGKIRRVAIREKDMN
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgtatgagaagtatatcggcaggcatcgtgatgagtttgtcacgctggaggat
ttatataaaaattattccatagattgccccgacgattttaactttgcctatgatgtgctc
gatgtgctggcggagaagaagcctgacaagctggcaatgctgtgggttggcaaagacggc
agtgaaaagagaattaccttcggagatatgaagcgctggtcgaacaaaacagcaaattat
tttaaagcgctggggattaaaaaaggcgattttgtcctgttggtactgaaaagaagttat
ttattttggtatgccatgctggctcttcacaaaatcggtgccgtagctgtccaggcaacg
cacctgttaacggccaaggattacgtttaccgctgtcaggcggccggcataaaaatggcg
gtcattacgggcgatggagattgcacccgagattttgacaaagccgctccggaatgtaac
accgtcgagctaaaagctgttacagggcataaggcagcgggggaaggctggctggatttt
gaggccggcattgaagccgcccctgaccattggcagcgtccaacgggagaagaggcaaca
aaagttacggatatattgattactgctttttcatccggcactaccggctatccaaagatg
gttgcccatgatcattcctatcccttaggccatattataacgggggtcttttggcacagg
gcggagccggacggcctgcatttcaccatttccgacaccggatggctgaagtctctgtgg
ggtaaattttatggtcaatggtttgctgagtcagcagtttttacctatgattttgatagc
tttaaaggggccgatatcctggaaaaattggccaaatatcgaattactacattttgtgct
ccgccaaccatgtacaggtttatgctgaaagaagatgtgggtacctacgatttatccgcc
ttaaaacactgctgcacggcgggagaagcattgaatcccgaggtttataatcagtggaaa
agggctacggggctgcgcatctttgagggctttggacagacggaaacaacgctgtcctgt
tccaccttgtacccatgggttcagccgaggccaggctctatggggctgccgaccccgggt
tatggtttggtgatagtcgatgaaaacggtcgcgaggtcgacccgggtgttaccggtgaa
atttgtttaaaagccgatagtatggaaaccagaacaaagggtatcttcatgggttattat
cgggatgaaatgagcacccaaaaagcatggcacgacggattgtaccatacaggagatact
gcctaccgtgatgaactgggttttttgtggtatgtgggcagaaatgatgacatcatcaaa
tcttccggttaccggatcgggccctttgaggtggagtcggcactggcagagcaccccgct
gttttggaatcagcggtgacgggcattccagatcccatcagggggtttgtggtgaaggcc
accattgtgctttccaagggctacgaaccctgtgaagagttggtcaaggaattacaggaa
catgtgaaaaaaacaaccgctccgtataaatatcccagggtagtcgagtttgtggcagag
ctccccaaaacaatcagcggaaaaattcgtcgggttgcaattagggaaaaagacatgaat
taa

DBGET integrated database retrieval system