KEGG   Desulfotomaculum ruminis: Desru_1528Help
Entry
Desru_1528        CDS       T01518                                 

Definition
nitrous-oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
dru  Desulfotomaculum ruminis
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dru00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Desru_1528
Enzymes [BR:dru01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Desru_1528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1553433..1555337
Genome map
AA seq 634 aa AA seqDB search
MEKDNYKKIALAITGLVVGIVMAVFLSARFGSATGDGGATTTLGATAAKDGVSEEVVEAA
LKTYVPPGKLDEYYLFASGGHSGNVFVYGVPSMRRLRTIPVFSKESAVGYGWTEESKKML
GEYTWGDAHHPALSETAGDYDGRWLFINDNANSRLARIDLKTFTTEQILGPIPNIYGPHG
SAFITPNSEYFMMASRFAGPIPYGKYAPLDKFKEEYMGLLAAVAIDPKNGHMSVGWELLL
PPWSYDLSDAGKKVSDGWAFLTTYNTEEASTLLEVNASQRERDYIVALNWKLLEQAAKEG
KYKEIGGAKVIDPREVPGSIYLVPCAKSPHGVDVSPDGKYFIGNGKLSPTVTVFSFEKFM
EAVKNKDLKGEERGLPIVNYEHVRVAEIEVGLGPLHTQFDNEGNAYTTLFVESAVAKWSL
KDFKVKDKVTVHYSPGHLSAAEGDTVSPDGKYLVSLNKLAKDKFLSVGPSHPESMQLVDL
TSQKMKILYDNPVDPEPHYAQMIKADKIKTIEVYPKDEKREGVVYKKEDARVVRSGNKVT
VYMMGYRSRYYPDQIEVNEGDHVTIYYTNTDLDEDITHGLGIMFYDLNLESQPGETGKIE
FIAKKPGVFPYYCTNFCSALHQEMQGFLLVKPKQ
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagacaattataaaaaaattgctctggccatcaccggtttggtggtgggtata
gtgatggcggtatttttgtcggcacgttttggctctgccacaggtgacggaggcgccact
accactttgggggcgaccgctgccaaagacggtgtttcggaagaagtggtggaagccgct
ttaaagacctacgtgccaccgggtaaactggatgagtattatctctttgcttccggcggg
cactccggcaacgtgtttgtttacggtgtgccttccatgcggcggcttcggacgattccc
gtcttttccaaagagtctgccgtaggttacggctggaccgaagaaagtaaaaaaatgctg
ggtgagtacacctggggcgacgctcatcacccggcccttagtgaaaccgcaggggattat
gacggtcgctggctgtttattaatgacaatgccaacagccgcctggccagaattgacctg
aaaacctttaccaccgaacaaatcctggggcctattcccaatatttacggcccccacggt
tcggcttttattactcccaacagtgagtactttatgatggcttcccgttttgccggtccc
attccctatggcaagtatgctccgttggacaaatttaaggaagaatatatgggtctgctg
gcagcggtggccattgatcccaagaacgggcatatgagcgtgggatgggaattgctgctg
ccgccctggtcctatgacctgtctgacgccggtaaaaaagtaagtgacgggtgggccttt
ttaactacctataacaccgaagaagcatctaccttactggaagtcaacgcctcccagcgg
gagcgggactacatcgtagccctcaactggaagctgctggagcaggcggccaaagaaggc
aagtataaagaaatcggcggggccaaggtgattgatccccgtgaggtgcccggctccatc
tacctggtgccctgtgccaagagtccccatggcgtggatgtttctcccgatggaaaatat
tttattggcaatggcaaactttctcccaccgttaccgtatttagttttgaaaaatttatg
gaagccgttaagaataaggacttaaaaggtgaggagcggggtttacccattgtgaattat
gagcatgtacgggtggcggaaatagaagtgggtctgggacccctgcatacgcagtttgac
aatgaaggaaacgcctacaccacattatttgtagaaagtgctgtagccaaatggtccctg
aaggattttaaagtgaaggacaaagtgaccgttcactactctcccggtcacctgtccgct
gccgaaggggataccgtttctccggatggtaaatacctggtctctttgaacaaactggcc
aaggacaaattcctgtctgtgggtccttcccatccggaatccatgcagttggtggacctg
acatcccaaaagatgaagattctctacgataacccggttgacccggaaccccattacgcc
caaatgatcaaggcggataagattaaaaccattgaagtttatcccaaggatgagaaacgg
gaaggggttgtttataagaaagaggatgcccgggtggttcgcagcggcaacaaagtaacc
gtatatatgatgggttaccgcagtcggtattaccccgaccagattgaagtgaacgagggt
gatcacgttaccatttactacaccaacaccgacctggatgaggatatcacccacggtttg
ggtatcatgttctacgacctcaacctggaatctcagcccggggaaaccggaaagatcgag
tttattgccaaaaaaccgggggtattcccttattactgcaccaacttctgttcggctctt
caccaggaaatgcagggcttcctgctggtaaagcccaaacaatga

DBGET integrated database retrieval system