KEGG   Desulfotomaculum ruminis: Desru_1624Help
Entry
Desru_1624        CDS       T01518                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
dru  Desulfotomaculum ruminis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Desru_1624
Enzymes [BR:dru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Desru_1624
Exosome [BR:dru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desru_1624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1653179..1654162
Genome map
AA seq 327 aa AA seqDB search
MPCFPTLRHRRLRWNEKVRQLVREHHLGVDDLIYPVFATYGQGIRRPVASMPGVFNLSLD
TLLEEIKEVVQLGIPGVLVFGIPEEKDEVGTGAYDEKGIVQQAVTAIKKAFPELLVITDV
CLCEYTSHGHCGLIIDGAVDNDSSLELIAQTALSHARAGADMVAPSDMMDGRVAAIRQKL
DGEGFTQMPIMAYSAKYASVYYGPFREAAGSAPQFGDRKTYQMDPANGDEAIRETRADIE
EGADIVMVKPALAYLDIVRRLKEEFDYPVAVYNVSGEYAMIKAAAEMGWIDERKIVLETL
TGFKRAGADIIITYHAKDVARWLREDK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgccgtgttttcctaccctgcgccatcggcgtttaagatggaacgaaaaagttcggcag
ttggtcagggagcaccaccttggggtggatgatctgatctatccggtttttgccacctat
ggccagggaatccgccgcccggtggccagtatgccgggtgtttttaacctgtccctggat
acccttttggaggaaatcaaagaagtggtgcaactgggtattcccggcgtgctggtcttt
ggcatcccggaggaaaaggatgaggttggcaccggcgcttacgatgaaaaaggcattgtg
cagcaggccgtaacagccataaaaaaggcttttccggaactgctggtgattaccgacgtt
tgcttgtgtgaatataccagccatgggcactgcggactcattatagatggtgcggtagac
aacgattccagcctggaattgattgcccaaacggctttgtcccacgcccgggccggggcg
gatatggtggccccttcagatatgatggacggccgggtggcggccattcgccagaagctg
gacggggaaggttttacccaaatgcctattatggcttactccgccaaatatgcctccgtt
tattatgggcccttccgggaagcagccggttccgcgcctcagtttggcgaccggaagacg
tatcagatggacccggccaacggggatgaggccatccgggaaaccagggcggatattgag
gaaggggccgatattgtcatggttaaaccggccctggcctacctggacattgtccgccgg
ctgaaagaggagtttgactatccggtggcggtttacaatgtcagcggtgaatatgccatg
attaaggctgccgctgaaatgggctggattgacgaacgtaaaattgttttagagacgcta
acgggctttaagcgggccggagcggatattattattacttaccatgctaaggacgtggcg
cggtggctcagggaggacaaataa

DBGET integrated database retrieval system