KEGG   Desulfotomaculum ruminis: Desru_2253Help
Entry
Desru_2253        CDS       T01518                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dru  Desulfotomaculum ruminis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desru_2253
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Desru_2253
   00640 Propanoate metabolism
    Desru_2253
   00660 C5-Branched dibasic acid metabolism
    Desru_2253
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desru_2253
Enzymes [BR:dru01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Desru_2253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2276152..2277273)
Genome map
AA seq 373 aa AA seqDB search
MKLYEYMGKEIFQREGIPVPRGKAFLTPGGVAEFAAELPSSVVKCQVLSGGRGKSGGIKF
PANPAEAEEAAQELLATVIRDLPVQAVLVEEKLKIDKEYYVAVTVDGGRRKPLVIASAQG
GVDIEEVSEEHLVKAHVDVHAGIQPFFGREVARRMGLPAAETGPFARLLVKMYELFRKYD
AELVEINPLVVSGEQLIAADAKITIDDEALFRLPGWVPRVEERSERELKAAEIGISFVEL
GGDIGVMANGAGITMATLDIINHFGGSPRNFMDAGGGAGTEATAKALEILLSTNPKAVLI
NIFGGITRCDDVARAFAQVKKNTGIHVPMVIRLVGTNEQAGVEILNQQGMSAYRTIHEAV
AKVVELAVGREAI
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatacgagtacatgggtaaggaaatatttcagcgggaaggaattccggttccc
aggggaaaggccttccttactcccgggggagtggccgaatttgcggcggagcttccctcc
agcgtagtgaagtgccaggttttgtccgggggcaggggtaagtccggcggcatcaagttc
ccggccaaccctgcggaggccgaggaagcggctcaggaattattggctaccgtcataagg
gatcttcccgtacaggcggtgctggtggaagaaaaattgaaaattgacaaggaatattat
gtggccgtcaccgttgacgggggaagacgaaagcctctggtcattgcttccgcccaaggc
ggtgtggatattgaagaggtctccgaggaacatctggtgaaagcccatgtggatgtccat
gccggcatccagcctttttttggccgggaagtggccaggcgcatgggtttgcctgcggca
gaaaccgggccttttgccaggcttctggtaaaaatgtatgagttattccgcaaatatgac
gccgagctggtggaaattaaccccctggtggtcagtggggagcaattgattgctgcagac
gctaaaataaccattgatgacgaggcccttttccggctgcccggttgggtacccagggtg
gaggaacgcagcgagcgggaattaaaagccgcggaaatcggcatctcctttgtggaattg
gggggggacatcggggtgatggccaacggggccggcattaccatggccactctggatatc
atcaaccactttggcggaagtccccggaacttcatggatgcagggggcggcgcagggacc
gaagccacggccaaagcactggaaatcttgctttctaccaatcccaaggcggttttaatt
aatatttttggcggcattacccgctgtgatgacgtggccagggcctttgcccaggtcaag
aagaataccggcattcatgtacccatggtgatccggctggtaggtaccaacgaacaggcc
ggagtggaaatattaaatcagcagggtatgagcgcctatcgaactattcacgaggcagtg
gccaaagtggttgaactggctgtgggcagggaggctatataa

DBGET integrated database retrieval system