KEGG   Desulfotomaculum ruminis: Desru_2318Help
Entry
Desru_2318        CDS       T01518                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dru  Desulfotomaculum ruminis
Pathway
dru00230  Purine metabolism
dru01100  Metabolic pathways
Module
dru_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dru00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Desru_2318
Enzymes [BR:dru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Desru_2318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 ADK AAA_22 AAA_16 Thymidylate_kin Cytidylate_kin RNA12 AAA_28 ABC_tran cobW Viral_helicase1 AAA_17 RsgA_GTPase MMR_HSR1 Rad17 RNA_helicase AAA_14 T2SSE
Motif
Other DBs
NCBI-ProteinID: AEG60563
JGI: Desru_2318
UniProt: F6DM96
Position
complement(2341199..2341801)
Genome map
AA seq 200 aa AA seqDB search
MSKQGLLIVVSGPSGAGKGTLCQELLKRNENLCLSVSCTTRAPRPGEQHKVNYFFVDKEA
FRQMIEDDQLLEYAQVYDHFYGTPRNYVMDKLEQGQDVILEIDIQGAMQIKQKHPRGILI
FVVPPCLSVLKDRLFKRGTDSAETIEKRLRCVCDELSKTGNYDYLVVNDTVEHVVEQVDA
IIKAEKCRPLCFDMQKFLDC
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacaaggacttctcattgtcgtatccggtccctccggcgccggtaagggtact
ctatgccaggaactgctgaaaaggaatgaaaatctttgtttatcggtttcctgcaccacc
cgtgcacccagacccggtgagcagcataaggtaaattatttttttgtagataaggaggca
ttccggcagatgatagaggatgatcaactgctggaatacgcccaggtttatgaccatttt
tacggcacgcccagaaattatgtcatggataagctggaacaagggcaggatgtaatcctg
gagattgacattcaaggtgccatgcaaatcaaacaaaaacatcctcgtggaattttaatc
tttgtggtacctccctgcctgtccgttttaaaagacaggctgtttaagcgaggaaccgat
tctgcggaaaccattgaaaagcgtttaaggtgtgtttgcgatgaactgtcgaaaaccgga
aattatgattacctggttgtcaatgatacggtagagcatgtggtggaacaggtggatgcc
attattaaagcggaaaaatgccgtcccctgtgttttgacatgcaaaaatttctggattgc
taa

DBGET integrated database retrieval system