KEGG   Desulfotomaculum ruminis: Desru_2565Help
Entry
Desru_2565        CDS       T01518                                 

Definition
germination protein Ger(x)C family
Organism
dru  Desulfotomaculum ruminis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2615168..2616280)
Genome map
AA seq 370 aa AA seqDB search
MRKSGLLFLLLLMMVFTTGCWDATDVNDLYIPFVAGYDYVGKNEQERYAMSINFPVFNRG
AQVQSDVMTLEGETMGETRIDRGNKSSRKMAIGDLRAVLLSENLASRGTEEVFDLLFRGP
QFTNTISLAVSEGKASDILNIKPKHYQTVGQNVIEILRNADKSNFTPCEDLHSFRVDVLT
PGFNPVLPILRIHDQDRLEISGAALFKKYKMVAKINKEDMRVLTWLRGKETQGDILFELE
DEQGEVKKVTFEGVNSRSVKAKMEKEHPFFEIQIKLKGSVIEDVGEFPFASKEENIQRAE
KALEDKIQKQCSVFLNDLQNQYRLDAILLGKYARYKWPSLVEKEDWDEVFCNSVIQVKVE
VKIQSTGEVA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaagcggtttactgttcctgctgctgctcatgatggtttttacaaccggctgc
tgggacgccaccgatgtcaacgacctttatattccctttgtggcgggctatgattatgtg
ggcaaaaatgagcaggagcgatatgccatgtccattaattttcccgtttttaaccgcggg
gctcaggtacaatcggacgtaatgaccttggaaggggaaaccatgggggaaacccggata
gaccggggcaacaaatcctcccgcaagatggccattggtgacctgagggcggtgctgctc
agcgaaaatttagccagccggggaaccgaggaggtatttgatttattatttcgcggccct
cagtttaccaatacaataagtttggccgtgagtgaggggaaagcttcagatatattgaat
attaaacccaagcattatcaaacggtaggccaaaatgtgattgaaatacttagaaatgcc
gacaagagcaacttcactccctgtgaagatctccattctttccgggtagatgtccttacc
cccggttttaacccggtattgccaattctgcgcattcatgaccaagaccgtttggaaatc
tcaggggcggccctgtttaaaaaatataaaatggtggccaagatcaataaagaggatatg
agagtattaacctggctgcgggggaaagagacccagggggatattttgtttgaactggag
gatgaacagggagaggtaaaaaaggtaacctttgaaggcgttaacagccgctcggttaaa
gccaaaatggaaaaggaacaccctttttttgagatacaaattaaattaaagggaagcgtg
atcgaggatgtgggcgaatttccatttgctagcaaggaggaaaatattcaaagagcagag
aaagccttagaggataaaattcaaaaacaatgttccgtatttttaaatgatttacaaaat
caataccggctggatgccatcctgttgggtaaatatgcccgctataagtggccctccctg
gtggaaaaagaggattgggacgaagttttttgcaacagcgtgatccaggttaaggtagag
gtgaagatccaaagtacaggggaagttgcttag

DBGET integrated database retrieval system