KEGG   Desulfotomaculum ruminis: Desru_2583Help
Entry
Desru_2583        CDS       T01518                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dru  Desulfotomaculum ruminis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dru00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2629958..2631481)
Genome map
AA seq 507 aa AA seqDB search
MIFDRESGILLHPSSLPAKYGIGDLGEEAYDFIDFLQGAKQRLWQILPLNPPGYGESPFQ
CYSAFAGNPLLISPDRLWAAGLLLKDDLQEVPEFCESRVQFALVREYKERLLRKAYQNFK
RKKKDSGYEEFIFEASWLKDFTLFMALKNYFKGLPWNQWESSIALREERAMAHYRTLLAE
EIAYHGFVQFIFFTQWLNLKKYANSREIKIIGDLPIFVSYDSSDAWAHPRLFELDEQGNP
AKVAGVPPDYFSETGQLWGNPLYRWEEMEKDGYRWWRERFNSLLKTVDIVRLDHFRGFEA
YWEIAAGQPTAVQGRWVKGPGEKFFRTMMKHLGDMPVIAEDLGLITPEVYELKDQFHFPG
MKVLQFHLHSSEKELYLPHHYESNTVVYTGTHDNDTTLGWYKGLLLEDPQEAAFLHQYLK
EYLDGVTTFPENICWQMIEVAFSTAANTVIIPLQDILCLDSDARMNFPGTVGGNWEWRLR
PGSLTPELQERLARLSVLYNRNNGTQI
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgatatttgaccgggaaagcggtatcttacttcatccaagctcattgccggcaaagtac
ggcatcggcgacctgggtgaggaggcctatgactttattgattttttacaaggggccaaa
caaagactatggcaaatcctgcccttaaacccgccgggttatggcgaatccccctttcaa
tgctactcggcctttgccggcaatcccctgttgatcagcccggaccgcttatgggccgca
gggcttcttttaaaggacgatttacaggaagtgccggagttttgcgaaagccgggttcag
tttgcacttgttagggaatacaaagaaaggcttttgagaaaggcttaccaaaattttaaa
agaaaaaagaaagattctggttatgaagaatttatttttgaggcttcttggttaaaagat
tttaccctttttatggccttaaaaaattatttcaagggattaccctggaatcaatgggaa
tcgtccatcgctctgagagaagaaagggccatggcccattaccgcactttgctggcggag
gaaatagcctaccatggctttgtccaatttattttcttcacccaatggctgaatcttaag
aaatatgccaacagcagggaaattaaaatcattggcgatctgcccatctttgtttcctat
gacagcagcgacgcctgggcccatccccgtctctttgaattggatgaacagggcaatccg
gccaaggtggccggggtgcctccggattatttcagcgaaaccggccagttatggggaaac
cctttgtaccgctgggaggagatggagaaagacggctaccgctggtggcgggaacgtttc
aacagtctgttaaaaaccgttgatatcgtacggcttgaccatttcaggggctttgaagcc
tactgggagattgcggccgggcagccaaccgccgttcagggccggtgggtgaagggaccc
ggagagaaattttttagaaccatgatgaagcatttgggagatatgccggtcattgccgag
gacctgggattgattaccccggaagtctatgaattaaaggatcaatttcattttcccggc
atgaaggtgctgcaatttcatctgcacagcagtgaaaaggaactgtatttaccacaccat
tatgagtcaaacaccgtagtttatacaggcacccacgacaatgacaccaccctgggctgg
tacaaagggctcctgctggaggacccccaggaggcggcctttctgcatcaatatttaaag
gaatatcttgacggggtgacaacattcccggagaatatttgctggcaaatgattgaagtg
gcctttagcaccgctgccaataccgtcatcattcctctacaggatattttgtgcctggac
agcgatgcccgcatgaatttccccggaacagtgggagggaactgggagtggaggctgcgt
ccggggagtctgaccccggagctgcaggagaggttagcccgtttgtcggtgctttataac
agaaacaatggaacgcagatttaa

DBGET integrated database retrieval system