KEGG   Desulfotomaculum ruminis: Desru_2912Help
Entry
Desru_2912        CDS       T01518                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
dru  Desulfotomaculum ruminis
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dru00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desru_2912
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Desru_2912
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Desru_2912
Enzymes [BR:dru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Desru_2912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2972176..2973276
Genome map
AA seq 366 aa AA seqDB search
MEIHKRIVIKIGSSSLTNPSGQLDGGRMQQLAEAVIQLYQNNWQPVLVSSGAVAAGLGHL
GWNRASLTMPERQAAAAVGQGLLMEKYNEFFLARGIRVGQVLLTKEDLADRRRYINARNT
LNALLGNQVLPIVNENDTVAFAEIRFGDNDTLSALVAGLVEAELLIILTDIDGLYSSDPR
KDPKAQLIPVVQQVDEKIARAAGGSGSPVGTGGMRTKLAAARIAARSGIRTVVTSGKNPE
ILVSIAAGKPRGTSFEPSVNCLKSRKQWIAFGSVPRGTVTVDGGAAKALLAGNKSLLAVG
VMDVAGNFSAGNVVAVADANGVELARGISNLSAEDLRLIIKNPQRGLEVINRDWLVCERS
FSGCPM
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtggaaattcataagcggattgttattaaaattggcagcagcagtcttaccaatccttcc
ggtcaattagacgggggacgcatgcagcaactggccgaggccgttattcaactttatcaa
aacaactggcagccggttctggtttcttccggggcggtggcagccggtttgggccacctg
ggatggaaccgggccagcttgaccatgcctgaaaggcaggcggctgcggcagtaggccag
ggccttttaatggaaaaatacaatgaattctttttagcccgtggaatcagggtggggcaa
gtcctcttaaccaaagaggatttggcggaccgccgccgttatattaacgcccgcaacacg
ctaaacgctttgctgggcaatcaggtcttacccattgtgaatgagaacgataccgtcgct
tttgcggaaatccgcttcggcgacaacgataccttaagcgctctggtagccggactggtg
gaggccgaactgctgattatcctgacggatattgacggtctgtacagcagtgatccccga
aaagacccgaaggcccaattgattcctgtggttcagcaggtggatgaaaaaattgcccgg
gcagccggcggcagcggcagtccggtgggcaccggaggaatgcgcaccaagctggcggcc
gcgcgcatcgccgccaggagcggcatccgtaccgtggttaccagtggcaaaaacccggaa
attctggtatccattgcagcggggaaaccccggggcacttcctttgaaccctctgtcaac
tgcctaaaaagccggaagcaatggattgcctttggcagtgtaccccgggggaccgtcacg
gttgacggcggggctgccaaagcgctgctggccgggaataaaagcttgctggcagtgggc
gtcatggatgtagcgggaaatttcagtgcggggaatgtggtggctgtggctgacgccaac
ggcgtcgagctggccaggggtatttccaatctttctgccgaagacttgcgcctgatcatc
aaaaacccgcaaaggggcttggaagtcatcaaccgggactggttggtttgtgaaaggagt
ttttcaggatgtcctatgtaa

DBGET integrated database retrieval system