KEGG   Desulfotomaculum ruminis: Desru_3597Help
Entry
Desru_3597        CDS       T01518                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dru  Desulfotomaculum ruminis
Pathway
dru00010  Glycolysis / Gluconeogenesis
dru00051  Fructose and mannose metabolism
dru00562  Inositol phosphate metabolism
dru01100  Metabolic pathways
dru01110  Biosynthesis of secondary metabolites
dru01120  Microbial metabolism in diverse environments
dru01130  Biosynthesis of antibiotics
dru01200  Carbon metabolism
dru01230  Biosynthesis of amino acids
Module
dru_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dru_M00002  Glycolysis, core module involving three-carbon compounds
dru_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dru00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desru_3597
   00051 Fructose and mannose metabolism
    Desru_3597
   00562 Inositol phosphate metabolism
    Desru_3597
Enzymes [BR:dru01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Desru_3597
Exosome [BR:dru04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Desru_3597
  Exosomal proteins of bladder cancer cells
   Desru_3597
  Exosomal proteins of melanoma cells
   Desru_3597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEG61799
JGI: Desru_3597
UniProt: F6DNA8
Position
complement(3644881..3645648)
Genome map
AA seq 255 aa AA seqDB search
MMRQLIIAGNWKMHKTVAEALSFVQELQSSGLDSRVEVVVCPAFTALAPVAEALKGSAIR
LAAQNMHWEAQGAFTGEISPLMLKELGCKYVILGHSERRQYDGETDEKVNRKVKAALEHS
LIPIICVGETLEQREAGKTAVTVETQTRAALSGLTTEQVAGLVFAYEPVWAIGTGKTASD
QDAQQVNGLIREIIAGAYGAEAADAVRIQYGGSVKPANTRGLMSQPDIDGALVGGASLKV
EDFAGIISEAQSSLI
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgacagttgatcattgccggtaactggaaaatgcataaaaccgtggctgaagcg
ttaagctttgtccaggagcttcagtcctccggcctggattcccgggtggaagtggtggta
tgtccggcttttaccgctctggctccggtggctgaggcattaaaaggaagcgctattcgt
ttggcggcccaaaacatgcactgggaggcccagggagcctttaccggggaaatttctccc
ttgatgctgaaggaattgggctgcaaatatgttattttgggccactccgagcgccgccag
tatgacggggaaacggacgaaaaggtaaaccggaaggtaaaggcagctctggagcacagt
ttgatccccattatttgcgtgggtgagactctggagcaaagggaagcaggaaaaacagcc
gttaccgtagaaactcagacgagagcggctttatccggtttaactaccgaacaggtagcc
ggactggtctttgcttatgaacctgtgtgggccattggcaccggaaaaacggcatccgat
caagatgctcaacaagtaaacggcttaattcgtgaaattattgccggtgcatatggtgcc
gaagctgcggacgccgttcgtattcaatatggtggcagtgtaaaacccgccaacacccgg
ggcttaatgtcccaaccggatattgacggagcgctggtgggcggggccagtcttaaagtg
gaggattttgcaggaattataagcgaggctcaaagctccttgatttga

DBGET integrated database retrieval system