KEGG   Desulfotomaculum ruminis: Desru_3647Help
Entry
Desru_3647        CDS       T01518                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dru  Desulfotomaculum ruminis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dru00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Desru_3647
   00052 Galactose metabolism
    Desru_3647
   00500 Starch and sucrose metabolism
    Desru_3647
   00520 Amino sugar and nucleotide sugar metabolism
    Desru_3647
Enzymes [BR:dru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Desru_3647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3701699..3702565)
Genome map
AA seq 288 aa AA seqDB search
MRVRKAIIPAAGLGVRFLPATKAQPKEMLPIVDTPTIQYIVEEAVASGIEDILIVTGRNK
RAIEDHFDKSLELELQLGHKNKDELLGLVRDISEMVDIHYIRQKEPLGLGHAVYCARKFI
GDEPFAVLLGDDVIKNKVPCLKQMINLYEEVRYSVLGVQEVPPEHVNRYGMVEATTEREG
VCRIYDLVEKPEVGQAPSSLAVMGRYILSPRIFDILAMTRPGAGGEIQLTDALRSLAKAE
AIYGCLFEGTRYDVGDKLGYLKATVEFALERPDLAGEFRKYLKELITE
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagagtccgcaaagccattatcccggctgccggactgggggtgcgttttttgcccgct
actaaggctcagcccaaggaaatgctgcccattgtggatacgccaaccattcaatacata
gtcgaggaagccgttgcctcaggaattgaagatattttaatcgtcaccggtcgaaacaag
cgggccattgaagatcattttgacaaatccctggaactggaactgcagttgggacataaa
aacaaggatgaacttctgggactggtccgggacatcagtgaaatggtggatatccactat
atccgccagaaggagcctctgggtttggggcatgcggtttattgcgcccggaagtttatt
ggagatgagccctttgccgttctgctgggagatgatgtcattaaaaacaaggttccctgc
ctgaagcagatgatcaatctatacgaagaggtgcgttattccgtattaggggtacaggaa
gttccgccggagcatgtaaaccggtacggtatggttgaggccaccacagaacgggaagga
gtttgccgcatttacgatctggtagaaaagcccgaagtgggccaagccccttcaagctta
gccgtaatgggccggtatattttaagtccccggatttttgatattctagccatgacccgg
cctggagccggcggtgaaatccaattgaccgatgccctccgctcgctggcgaaagccgag
gccatttatggctgcctttttgaaggcacacgttatgatgtgggggataagttaggttat
ttaaaggctaccgttgaattcgccctggaaagaccggatttggccggggagtttcggaaa
tatttaaaagaattgatcacagagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system