KEGG   Desulfotomaculum ruminis: Desru_3861Help
Entry
Desru_3861        CDS       T01518                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dru  Desulfotomaculum ruminis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desru_3861
   01230 Biosynthesis of amino acids
    Desru_3861
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desru_3861
   00030 Pentose phosphate pathway
    Desru_3861
   00051 Fructose and mannose metabolism
    Desru_3861
   00052 Galactose metabolism
    Desru_3861
  Energy metabolism
   00680 Methane metabolism
    Desru_3861
Enzymes [BR:dru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Desru_3861
Protein phosphatases and associated proteins [BR:dru01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Desru_3861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3929686..3930840
Genome map
AA seq 384 aa AA seqDB search
MQKQNKLFIAQSGGPTAVINSSLAGIIAAAQNSGVIAGIYGLFNGLEGALKEEIVDLTHL
SRQEIQLLRHTPAAALGGSRYIMKEEDYRQAVRFLEKQGAGHFLFIGGNGTMGTCHKLKQ
VAEEMGVAMTVNGVPKTIDNDLVGLDHAPGYASAARYVALAVKAQGADLRSMRTFEQVRI
IETMGRAVGWLAAASALAQEHPEDPPHLVYLPEVPLAINDFLEDVQKMYRRHGYVVAVVG
EGMKDVNGHPIGCEQFQNEEGTRPVIVGASEHLSKLVKSRLGLVARSQNLGMTQRSFSEC
VSLFDEEFAYECGRAAFLASMEGKKGRMIWQDGDLPLKKVAGLVQTYPNYFYDMGKKQPT
SAFHQWLSPLIGSMPSYFNIHLKD
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagcaaaataagctatttatcgctcagtccgggggccctacggcggtgatcaac
agttcgctagccggcattatcgctgctgcccagaatagcggtgtaatagcgggaatttac
ggtttgttcaacggcttagaaggggccttaaaagaggaaatcgttgatttgacccacttg
tccaggcaagaaattcaacttttacggcatacaccagccgctgccctaggcggaagtagg
tatattatgaaggaagaagattaccggcaggcagtacgctttttggaaaagcagggtgcc
gggcattttcttttcattggcggtaacggaactatgggaacgtgccataaattgaagcaa
gttgcggaggaaatgggcgttgccatgaccgttaatggagtacccaagaccatagacaat
gacttggttggcctggatcatgcccccggctacgccagtgcggcccggtacgtagcctta
gcggttaaagcccagggtgccgatttgagatccatgcgtacctttgaacaagtaagaatt
attgaaaccatgggcagggcggtgggctggctagctgccgcctcggcgctggctcaagag
catccggaagatccgcctcatcttgtctatctgccggaggtccccttagccatcaatgac
tttcttgaagatgttcaaaaaatgtatcggcgccatggctatgtggtagccgttgtggga
gaaggcatgaaagacgtaaatggacaccctatcggctgtgaacagttccagaacgaggag
ggcacccgtccggttattgtgggggcatcagagcacctgtctaaactggttaaaagccgg
ttagggctggtagcccgaagccaaaatctggggatgacccaacgcagtttctccgaatgt
gtctctttgtttgatgaagaattcgcctatgaatgcgggcgggcggccttcctggcctca
atggaaggaaaaaagggacgtatgatttggcaagacggcgatcttcccttgaaaaaagtt
gcggggttggtacagacctatccgaattatttttatgatatgggcaaaaagcagccgacg
agcgcttttcaccaatggttgtccccactaataggttccatgccctcttattttaatatt
catcttaaggactga

DBGET integrated database retrieval system