KEGG   Desulfotomaculum ruminis: Desru_3861Help
Entry
Desru_3861        CDS       T01518                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dru  Desulfotomaculum ruminis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:dru01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dru01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dru00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dru00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dru00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dru00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:dru00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3929686..3930840
Genome map
AA seq 384 aa AA seqDB search
MQKQNKLFIAQSGGPTAVINSSLAGIIAAAQNSGVIAGIYGLFNGLEGALKEEIVDLTHL
SRQEIQLLRHTPAAALGGSRYIMKEEDYRQAVRFLEKQGAGHFLFIGGNGTMGTCHKLKQ
VAEEMGVAMTVNGVPKTIDNDLVGLDHAPGYASAARYVALAVKAQGADLRSMRTFEQVRI
IETMGRAVGWLAAASALAQEHPEDPPHLVYLPEVPLAINDFLEDVQKMYRRHGYVVAVVG
EGMKDVNGHPIGCEQFQNEEGTRPVIVGASEHLSKLVKSRLGLVARSQNLGMTQRSFSEC
VSLFDEEFAYECGRAAFLASMEGKKGRMIWQDGDLPLKKVAGLVQTYPNYFYDMGKKQPT
SAFHQWLSPLIGSMPSYFNIHLKD
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagcaaaataagctatttatcgctcagtccgggggccctacggcggtgatcaac
agttcgctagccggcattatcgctgctgcccagaatagcggtgtaatagcgggaatttac
ggtttgttcaacggcttagaaggggccttaaaagaggaaatcgttgatttgacccacttg
tccaggcaagaaattcaacttttacggcatacaccagccgctgccctaggcggaagtagg
tatattatgaaggaagaagattaccggcaggcagtacgctttttggaaaagcagggtgcc
gggcattttcttttcattggcggtaacggaactatgggaacgtgccataaattgaagcaa
gttgcggaggaaatgggcgttgccatgaccgttaatggagtacccaagaccatagacaat
gacttggttggcctggatcatgcccccggctacgccagtgcggcccggtacgtagcctta
gcggttaaagcccagggtgccgatttgagatccatgcgtacctttgaacaagtaagaatt
attgaaaccatgggcagggcggtgggctggctagctgccgcctcggcgctggctcaagag
catccggaagatccgcctcatcttgtctatctgccggaggtccccttagccatcaatgac
tttcttgaagatgttcaaaaaatgtatcggcgccatggctatgtggtagccgttgtggga
gaaggcatgaaagacgtaaatggacaccctatcggctgtgaacagttccagaacgaggag
ggcacccgtccggttattgtgggggcatcagagcacctgtctaaactggttaaaagccgg
ttagggctggtagcccgaagccaaaatctggggatgacccaacgcagtttctccgaatgt
gtctctttgtttgatgaagaattcgcctatgaatgcgggcgggcggccttcctggcctca
atggaaggaaaaaagggacgtatgatttggcaagacggcgatcttcccttgaaaaaagtt
gcggggttggtacagacctatccgaattatttttatgatatgggcaaaaagcagccgacg
agcgcttttcaccaatggttgtccccactaataggttccatgccctcttattttaatatt
catcttaaggactga

DBGET integrated database retrieval system