KEGG   Desulfovibrio salexigens: Desal_0013Help
Entry
Desal_0013        CDS       T00969                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dsa  Desulfovibrio salexigens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desal_0013
   01230 Biosynthesis of amino acids
    Desal_0013
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desal_0013
   00030 Pentose phosphate pathway
    Desal_0013
   00051 Fructose and mannose metabolism
    Desal_0013
   00052 Galactose metabolism
    Desal_0013
  Energy metabolism
   00680 Methane metabolism
    Desal_0013
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Desal_0013
Enzymes [BR:dsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Desal_0013
Protein phosphatases and associated proteins [BR:dsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Desal_0013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10235..11572
Genome map
AA seq 445 aa AA seqDB search
MVKKANKAEQINTEIPVLGKAKIPSPLKRCVFIEDKERTLVNLAEEEMDSSSGNDVYQEF
EKAGPRAFTYFDPSKTKCAVVTCGGLCPGLNDVIRSIVLEAHYLYKVPSVLGIKFGLQGF
IPKYGHDVVELTADTVANIHQFGGTVLGSSRGPQDPEEVVDALERMNISVLFMIGGDGTM
RAAQKIVEEIEKRKIRISIIGVPKTIDNDISFVTKSFGFDTAVDKATEAIQSAHVESVGV
VNGIGLVKLMGRESGFIAAQATLALKDVNFVLVPEHPFEFDGEYGLLRSLEKRLDERQHA
VIVCAEGAGQEQCEYTGEKDASGNPVLCDVCTLIIRRIKDYFKDVGKDITLKFIDPSYII
RSVPANANDCVYCGFLGQHAVHAAMAGKTGMVVSRLQARYVHLPLNLVTIKRKKLNIKSD
YWRAVLESTGQGHLRNDMEKDICEI
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggttaaaaaagctaacaaagcagagcagataaataccgagatcccggtgttgggtaag
gcgaaaattccttctccgctcaaacgttgtgtctttattgaagataaggaacgaaccttg
gtcaaccttgctgaagaggaaatggattcatcttccggcaatgatgtttatcaggaattt
gaaaaagccggtcctcgtgcatttacctattttgatccttcaaaaaccaagtgtgcggtg
gttacctgtggtggactttgccccggtctgaacgatgttatccgttcgatcgtacttgag
gcccactacctgtataaggttccttccgtactgggtatcaagttcggcttgcagggtttt
atccccaagtacggacatgatgttgtagagcttacagccgatactgtagcaaatattcac
cagttcggcggaacagttcttggttcttctcgtggtccgcaggaccctgaagaggttgtc
gatgcattggaacgcatgaacatttcagtgctgttcatgatcggcggtgacggaaccatg
cgtgcggctcagaaaattgtggaagagattgagaaaagaaaaatcagaatttccattatc
ggtgtccccaaaaccattgataatgacatcagttttgtcaccaagtctttcggttttgat
accgctgtagacaaggcaacagaagccatccagtccgctcatgttgaatccgtgggtgtt
gttaacggcatcggtctggtaaagcttatgggccgtgaatcaggctttatcgctgcgcag
gctactttggctcttaaagacgtaaactttgtgctcgtgcccgaacatccctttgagttt
gacggggaatacggcttgcttcgctctcttgaaaagcgtctggatgaacgccagcatgcg
gtcattgtctgtgcagagggagcagggcaagaacaatgcgaatacaccggggaaaaggat
gcatccggcaaccccgtgctttgtgatgtctgcactctgatcattcgccgcatcaaggac
tacttcaaggatgtgggcaaggacatcaccttgaagttcattgaccccagttacattatc
cgttcagtcccggctaatgccaacgattgcgtttattgcggtttcttaggtcagcatgca
gtacacgcagcaatggcaggaaagaccggaatggtggtcagccgtttgcaggctcgctac
gtgcacctgccgcttaatttggtaaccatcaagcgcaagaagttgaacatcaagtccgac
tactggcgtgcagttctcgaatccaccggtcagggccatctgcgcaatgacatggagaag
gatatttgtgaaatatag

DBGET integrated database retrieval system