KEGG   Desulfovibrio salexigens: Desal_0017Help
Entry
Desal_0017        CDS       T00969                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
dsa  Desulfovibrio salexigens
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:dsa00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:dsa00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(15750..16673)
Genome map
AA seq 307 aa AA seqDB search
MEWRHKDLLDVTQLNKEEVQHIFETATYFQEINSRPVKKVPTLKGHSVVLFFAEASTRTK
TSFDMAGKRLSCDTFSLAKSSSSLTKGETLKDTALTLQAMNPDGIVLRHWASGASQFLAE
RLDCSIINAGDGRHAHPTQALLDGFTLYQEWGSLEGKTVLILGDIAHSRVARSNLILMNK
MGAKVRFCGPRTLLPPQIRKWDAEVYTDINEACKGVDAIMCLRLQLERQQDGLLPDLREY
SNYFGLGHKQIELANPDVKIMHPGPMNRGVEINSELADCEASLVLDQVASGVATRMALLY
LYLTRKK
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggaatggcgacataaagatttgctggatgttacccagctcaacaaagaggaagtgcag
cacatttttgaaactgctacttactttcaggaaatcaactcccgtccggtaaaaaaggta
ccgactttaaaaggccatagcgtggtccttttttttgccgaagcaagcacaagaaccaag
acctcctttgacatggccgggaaacgtctttcctgtgacacattctcccttgccaaaagc
tccagcagtctgaccaagggcgagactctcaaggataccgccctgacattgcaggccatg
aacccggacggaattgtcctgcgccactgggccagcggtgcttctcaatttctggcagag
cgcctcgattgcagtatcatcaacgcaggtgacggccgccatgcccaccccacacaggcc
ttgcttgacggtttcacactctatcaggaatggggatctctggaaggtaagacagttctc
atcctcggtgatatcgcacacagtcgtgtagcgcgttcaaacctgatcctgatgaataag
atgggtgccaaggttcgtttctgcggccctcgcacactgctgcctccgcagatcagaaaa
tgggacgcagaagtttacaccgacatcaacgaagcctgcaaaggtgtggatgcaatcatg
tgtctccgacttcagctggaacgccagcaagacggtcttctgcctgacctgcgtgagtac
tccaactacttcggtctggggcacaaacaaattgagcttgccaatcctgatgtaaagatc
atgcatcccggacccatgaaccggggagtcgaaatcaattccgagcttgccgactgcgaa
gccagcctcgtacttgatcaggtcgcatccggtgtagctacccgcatggccttactctac
ctctacctcacccgcaaaaaataa

DBGET integrated database retrieval system