KEGG   Desulfovibrio salexigens: Desal_0092Help
Entry
Desal_0092        CDS       T00969                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dsa  Desulfovibrio salexigens
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dsa01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dsa00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dsa00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dsa00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:dsa00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
97606..99474
Genome map
AA seq 622 aa AA seqDB search
MDHKETLDSLLHEERVFRPLPQMLIEAGVNPQDLRAARELAEVDLCSYWEEAAEELDWFK
KWEQVCDISDAPNYRWFSGARCNIVYNALDRHIETVNKNRLALIWEGEPGDSRQYTYYEL
YRAVNRFANGLKALGVGKGDRVVLYMPQLPETVIAMLACARIGAVHSMVFSGFSARLLRE
RVREVDPRVVVTVDGFYRNGQVIRLKEEVDRALLDDPAQNLESVVVVHRANVDVNMDSAR
DCWYEDLVRHERPHAPAEIMAADDPLFIMHTSGTTGKPKGLVHSHGGYMVGVHRTFKWVF
DLKPTDIFWCSADPGWITGHSYLVYGPLLAGTTTVMYEGHSLYPQADRLWNIVSKYGVTI
FYTSPTQIRTLMRFGHRYPEQHDLSSLRILGAVGEPFNTEAWLWMYENIGKGQCPVLDTW
WQTETGMIMISPLPVSVLKPGSVTRPLPGIDADVVDAEGNPVPDGKGGLLVIKKPWPAMF
SDVIGDREEVMAHYWKRIPGMFYAGDVARKDEDGYFWIQGRADDVLNISGHRIGTAEVEC
ALTKHPQVAEAAVVGVVDKIKGQVAKAYVTLNHGFVESDDLHRELKEQVRRELGPIVIVR
SIEFRDELPKTSSGKIKRTELG
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
gtggatcataaggaaacactggacagcctgttgcatgaagagagagttttccgtcccctg
cctcagatgcttattgaggccggggtcaatccgcaggatctgcgcgcggcgcgtgaactt
gcggaagtggatctctgctcctattgggaagaagcagccgaagaactggactggtttaaa
aaatgggaacaagtctgcgatatttccgatgcacccaattatcgttggttcagcggagcg
cgttgtaacattgtctacaacgcccttgaccgtcatatagagactgtaaacaagaatcgt
ctggccttgatctgggaaggtgagccgggggattcccgccaatacacttattatgaactt
tatcgggctgtgaaccgttttgccaacggcctgaaagcgcttggcgtaggtaaaggtgac
cgggtggtcctttacatgcctcagcttcctgaaacagtgatcgccatgcttgcctgcgcc
cgtatcggtgccgtgcattcaatggttttttctggattttcagcacgactgctgcgtgag
cgtgtccgtgaagttgatccccgtgtggttgttactgtggacggtttttaccgtaacggg
caggtcatccgtcttaaggaagaggttgaccgtgcactgctggacgatcctgcacagaat
ctggaatctgtggtcgtggtccatcgggccaacgtggacgtgaacatggattccgcccgt
gactgctggtacgaggatcttgtgcgtcatgaacgtccgcacgctcctgccgagattatg
gctgccgatgatcccctgttcatcatgcatacttcgggcaccacaggaaaacccaaaggt
ttagtccattcccacggcggatatatggtcggtgtgcaccgtaccttcaaatgggtcttt
gatcttaagcctacagatattttctggtgttctgctgatccgggctggatcaccgggcac
agctaccttgtttacggccccctgctggccgggaccactaccgttatgtatgaggggcac
tccctctatccgcaggcagaccgactctggaatattgtttccaaatacggggtcacaatt
ttttatacttctcctactcagatcaggacccttatgcggttcggtcaccgctatcctgag
cagcacgacctttcttcactgcgcattctcggtgcggttggtgagccgttcaatactgaa
gcatggctctggatgtacgagaatatcggtaagggccagtgtccggtgctggatacatgg
tggcagaccgagaccggaatgattatgatcagcccgttgccggtgtctgttctgaagccc
ggttccgtgaccagacctctgccgggaattgacgctgatgttgttgatgctgaaggtaat
cctgtacctgatggcaagggtggtttgctggtgatcaagaaaccttggcctgccatgttc
agtgatgtgatcggtgatcgtgaagaggtcatggctcattattggaagcgcattccgggc
atgttctatgccggggacgttgcccgcaaggatgaagacggctacttctggattcagggc
cgcgctgatgacgtgcttaatatttcaggacaccgcattggaaccgccgaggtggaatgt
gcgctgactaagcatccgcaggttgcggaagctgctgtggttggtgttgtggataagatt
aaggggcaggttgccaaggcgtatgtgaccttgaatcatggttttgtagagtcagacgac
ctgcaccgtgagttgaaagaacaggtccgccgtgagctgggccccatcgtcatcgtgcgt
tctatcgaattcagggatgaactgcccaagacatccagcggtaagatcaagcgtactgag
ttggggtaa

DBGET integrated database retrieval system