KEGG   Desulfovibrio salexigens: Desal_0092Help
Entry
Desal_0092        CDS       T00969                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dsa  Desulfovibrio salexigens
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desal_0092
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desal_0092
   00620 Pyruvate metabolism
    Desal_0092
   00640 Propanoate metabolism
    Desal_0092
  Energy metabolism
   00680 Methane metabolism
    Desal_0092
Enzymes [BR:dsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Desal_0092
Lipid biosynthesis proteins [BR:dsa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Desal_0092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
97606..99474
Genome map
AA seq 622 aa AA seqDB search
MDHKETLDSLLHEERVFRPLPQMLIEAGVNPQDLRAARELAEVDLCSYWEEAAEELDWFK
KWEQVCDISDAPNYRWFSGARCNIVYNALDRHIETVNKNRLALIWEGEPGDSRQYTYYEL
YRAVNRFANGLKALGVGKGDRVVLYMPQLPETVIAMLACARIGAVHSMVFSGFSARLLRE
RVREVDPRVVVTVDGFYRNGQVIRLKEEVDRALLDDPAQNLESVVVVHRANVDVNMDSAR
DCWYEDLVRHERPHAPAEIMAADDPLFIMHTSGTTGKPKGLVHSHGGYMVGVHRTFKWVF
DLKPTDIFWCSADPGWITGHSYLVYGPLLAGTTTVMYEGHSLYPQADRLWNIVSKYGVTI
FYTSPTQIRTLMRFGHRYPEQHDLSSLRILGAVGEPFNTEAWLWMYENIGKGQCPVLDTW
WQTETGMIMISPLPVSVLKPGSVTRPLPGIDADVVDAEGNPVPDGKGGLLVIKKPWPAMF
SDVIGDREEVMAHYWKRIPGMFYAGDVARKDEDGYFWIQGRADDVLNISGHRIGTAEVEC
ALTKHPQVAEAAVVGVVDKIKGQVAKAYVTLNHGFVESDDLHRELKEQVRRELGPIVIVR
SIEFRDELPKTSSGKIKRTELG
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
gtggatcataaggaaacactggacagcctgttgcatgaagagagagttttccgtcccctg
cctcagatgcttattgaggccggggtcaatccgcaggatctgcgcgcggcgcgtgaactt
gcggaagtggatctctgctcctattgggaagaagcagccgaagaactggactggtttaaa
aaatgggaacaagtctgcgatatttccgatgcacccaattatcgttggttcagcggagcg
cgttgtaacattgtctacaacgcccttgaccgtcatatagagactgtaaacaagaatcgt
ctggccttgatctgggaaggtgagccgggggattcccgccaatacacttattatgaactt
tatcgggctgtgaaccgttttgccaacggcctgaaagcgcttggcgtaggtaaaggtgac
cgggtggtcctttacatgcctcagcttcctgaaacagtgatcgccatgcttgcctgcgcc
cgtatcggtgccgtgcattcaatggttttttctggattttcagcacgactgctgcgtgag
cgtgtccgtgaagttgatccccgtgtggttgttactgtggacggtttttaccgtaacggg
caggtcatccgtcttaaggaagaggttgaccgtgcactgctggacgatcctgcacagaat
ctggaatctgtggtcgtggtccatcgggccaacgtggacgtgaacatggattccgcccgt
gactgctggtacgaggatcttgtgcgtcatgaacgtccgcacgctcctgccgagattatg
gctgccgatgatcccctgttcatcatgcatacttcgggcaccacaggaaaacccaaaggt
ttagtccattcccacggcggatatatggtcggtgtgcaccgtaccttcaaatgggtcttt
gatcttaagcctacagatattttctggtgttctgctgatccgggctggatcaccgggcac
agctaccttgtttacggccccctgctggccgggaccactaccgttatgtatgaggggcac
tccctctatccgcaggcagaccgactctggaatattgtttccaaatacggggtcacaatt
ttttatacttctcctactcagatcaggacccttatgcggttcggtcaccgctatcctgag
cagcacgacctttcttcactgcgcattctcggtgcggttggtgagccgttcaatactgaa
gcatggctctggatgtacgagaatatcggtaagggccagtgtccggtgctggatacatgg
tggcagaccgagaccggaatgattatgatcagcccgttgccggtgtctgttctgaagccc
ggttccgtgaccagacctctgccgggaattgacgctgatgttgttgatgctgaaggtaat
cctgtacctgatggcaagggtggtttgctggtgatcaagaaaccttggcctgccatgttc
agtgatgtgatcggtgatcgtgaagaggtcatggctcattattggaagcgcattccgggc
atgttctatgccggggacgttgcccgcaaggatgaagacggctacttctggattcagggc
cgcgctgatgacgtgcttaatatttcaggacaccgcattggaaccgccgaggtggaatgt
gcgctgactaagcatccgcaggttgcggaagctgctgtggttggtgttgtggataagatt
aaggggcaggttgccaaggcgtatgtgaccttgaatcatggttttgtagagtcagacgac
ctgcaccgtgagttgaaagaacaggtccgccgtgagctgggccccatcgtcatcgtgcgt
tctatcgaattcagggatgaactgcccaagacatccagcggtaagatcaagcgtactgag
ttggggtaa

DBGET integrated database retrieval system