KEGG   Desulfovibrio salexigens: Desal_0633Help
Entry
Desal_0633        CDS       T00969                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
dsa  Desulfovibrio salexigens
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desal_0633
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Desal_0633
Enzymes [BR:dsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Desal_0633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(689517..690356)
Genome map
AA seq 279 aa AA seqDB search
MKDLTLVFPQWQGSINNKALHKGAYALAEGIADLPAVTTVEIEPFRKLESGGPIAGLGDI
VQQLKNVLSIIEQAKPERVLMIGGDCGTELGPVSWMSRKHGDKMALIWFDAHPDLNTPET
SKSGRFQGMALSAILGSAGPEINKAMFNPLSSKQIFLAGTRSFDPPELEFMTRNKITIFG
PEEFTRDPAWLAKQIKEAGFSKVYIHLDVDAVDPLGFGHGKPAPPAGLNFGNVLKIIEEV
NSRLDICGLGITEFHPGNESGIEKAALLIEKTLPGFTTK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagatctcactcttgttttcccgcaatggcagggatcaataaataataaagcactt
cataagggggcttatgcactggcagaaggtatagcagacctccctgctgttactacggtg
gaaatcgaacctttcagaaaacttgaatcaggtggacccattgcagggctgggcgatatt
gttcagcagctgaaaaatgtcctttccataattgagcaggctaaaccggaacgtgtcctg
atgattggaggggactgcggaacagaactcggtccggtttcatggatgtcccgcaaacat
ggcgacaaaatggccttgatctggtttgacgcccatcccgaccttaacacaccggagact
tctaaatccgggcgttttcaagggatggccctttccgccattctcggcagcgcaggaccg
gaaattaacaaggcaatgttcaatccgctgagctccaaacagatattcctcgccggcacc
agatcttttgatcccccggaactggaattcatgacgcgcaacaagataactattttcgga
cccgaagaatttaccagggatccggcatggttagcaaagcaaatcaaagaagcaggattc
agtaaagtatacatccatcttgatgtggacgcagtcgaccctctcggtttcgggcatggc
aaaccagctcctccggcaggactcaatttcggaaacgtcctaaaaataatcgaagaagtg
aacagcaggctggacatatgcggactggggataactgaattccaccccggaaacgaaagt
gggatagaaaaagcagctttgctcattgaaaagactcttcccggatttaccactaagtaa

DBGET integrated database retrieval system