KEGG   Desulfovibrio salexigens: Desal_0696Help
Entry
Desal_0696        CDS       T00969                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
dsa  Desulfovibrio salexigens
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Desal_0696
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Desal_0696
Enzymes [BR:dsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Desal_0696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(756299..757759)
Genome map
AA seq 486 aa AA seqDB search
MSKTVLNKAKWDALLAKVGEGLMVQTDSREVREGDVFVAISGPLSDGADFVPQALEKGAA
YIVCEKEVETGSAELISHPSPREALGELAMTYFKTADSKIKLVGITGTNGKTTTTYLIEQ
LLSSAGMKVGVLGTVSYRWPGYEQEAPLTTPGCWQLHEMLAKMDEAGVDVAVMEVSSHAL
HQNRVCGLKFDAAVITNVTQDHLDYHGDMEEYFKAKCMLFQHYPSALKRGIINFDDPFGR
RLLECYSPAIGYGMDASCATGCKSLCGEMVSCTGDGMRLKMTCDGEQWEIETDLIGKFNG
SNLLAAQAIGLHMGLTPKQMNVFKEFDGVPGRLERVRNDQGLNIFVDYAHTPDALDNVLR
TLKDLDFNKVITVFGCGGDRDRAKRPLMAEAACRYSDVAVLTSDNPRTEDPMQIIDDARP
GLKGCDHVIEEVDRADAIRKAVAEMTEDDVLLIAGKGHETYQIIGTEKRDFSDSEEVLKA
IKEIYG
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaacagtactgaataaagcaaaatgggacgcacttctcgccaaggtcggcgag
gggttgatggtccagacagattcacgggaagtccgcgaaggtgatgtatttgtcgccatt
tccggtcctcttagtgacggtgctgatttcgtgcctcaggcacttgaaaaaggtgccgct
tacatcgtttgcgagaaagaagttgaaaccggttctgctgagctgatatcccacccatcc
ccccgtgaagctctgggcgaactggcaatgacttatttcaaaaccgcagacagcaagatc
aagctggtgggcataaccggaacaaacggcaagaccaccaccacatacctgatcgaacag
ctgctttcttccgcagggatgaaagtgggcgtactcggaacagtcagctaccgctggccc
ggatatgaacaggaagccccgctgacaacccccggttgctggcagctgcacgaaatgctc
gccaagatggacgaagcaggtgtggatgtagcagttatggaagtttcatcccatgctctg
caccagaaccgtgtttgcggtcttaaattcgatgctgcagtaatcaccaacgtcactcag
gaccacctcgattaccacggagacatggaagagtacttcaaggcaaaatgcatgctcttc
cagcactaccccagcgcactcaagcgaggcatcatcaacttcgatgatcccttcggaaga
cgtctgctggaatgctactccccggcaatcggttacggcatggacgcttcctgcgccaca
ggctgcaaatccctgtgcggcgagatggtctcctgtaccggtgacggcatgcgcctcaaa
atgacctgcgatggcgaacagtgggaaatcgaaaccgaccttatcggtaagtttaacggt
tccaacctgctggcagcacaggctatcggcctgcacatggggcttactcccaagcagatg
aatgttttcaaagagtttgacggggttcccggaaggctcgaacgggtccgcaatgatcag
ggactcaacattttcgtggactatgcccacaccccggatgcgctggataacgtcctgcgt
accctgaaggaccttgatttcaacaaggtcatcactgtgttcggctgcggtggagaccgc
gaccgggccaaacgtccgctaatggctgaagctgcctgtcgctattccgatgtggcggtg
ctgacctcagacaacccgcgcaccgaagatcccatgcagatcatcgacgatgcccggccc
ggactcaaaggctgtgaccacgtcatcgaagaggttgaccgtgccgatgcgattcgcaaa
gcggttgcggaaatgactgaggatgacgtgctgctcatcgcaggcaagggacacgaaaca
taccagattatcggtacggaaaagcgggacttcagcgacagcgaagaagtcttaaaggca
attaaggagatttacggttga

DBGET integrated database retrieval system