KEGG   Desulfovibrio salexigens: Desal_0722Help
Entry
Desal_0722        CDS       T00969                                 

Gene name
frdB
Definition
fumarate reductase iron-sulfur subunit (EC:1.3.99.1)
Orthology
K00245  
fumarate reductase iron-sulfur subunit [EC:1.3.5.4]
Organism
dsa  Desulfovibrio salexigens
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Pyruvate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desal_0722 (frdB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Desal_0722 (frdB)
   00620 Pyruvate metabolism
    Desal_0722 (frdB)
   00650 Butanoate metabolism
    Desal_0722 (frdB)
  Energy metabolism
   00190 Oxidative phosphorylation
    Desal_0722 (frdB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Desal_0722 (frdB)
Enzymes [BR:dsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.4  fumarate reductase (quinol)
     Desal_0722 (frdB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
796531..797268
Genome map
AA seq 245 aa AA seqDB search
MSRQLEFDIFRYNPQDKGSVPHMQTFVLDETENMTLFIALNRLREEQDPGLIFDFCCRAG
ICGACAMVVNGKPRLACQTKTVDLPERITLLPLPVYKLIGDLSVDTGVWFREMYQTTESW
IHTTKTFDPNAIEERMENEVAEQIYELERCIECGCCVAACGTARLRDDFLGAASLNRVAR
FVVDPRDQRTDRDYFEIIGNDEGIFGCMGLLGCEDVCPKNLPLQNQLGFLRRKMGITAIK
EIFRK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagcagacaactcgaatttgatatattccgctacaatcctcaggataaggggtcggtt
ccgcacatgcagacctttgtgctggatgaaaccgagaacatgactctgtttattgcgctg
aaccgtttgcgcgaagagcaggaccccggcctgatttttgacttctgttgccgtgccggt
atctgcggtgcctgtgcaatggtggtcaacggtaaaccccgtctggcctgccagaccaaa
acagttgaccttcctgaacgcataaccctgctgcccctgcccgtatataaactgatcggc
gacctttcagttgataccggtgtctggttcagggaaatgtatcagaccacagaatcatgg
attcatactaccaaaacctttgatcccaatgccattgaagagcgtatggagaatgaggtt
gccgagcagatctacgaactggaacgctgcattgaatgcggctgctgtgttgccgcttgc
ggtaccgcacgccttcgtgacgacttcctcggtgctgcatccttgaaccgtgtggcccgt
ttcgtagtcgacccccgcgatcagcgtaccgaccgcgactactttgaaattatcggtaat
gatgaaggtatcttcggctgcatgggcttgctcggctgtgaagatgtctgccccaagaat
cttccgttgcagaaccagctcggtttcctgcgccgcaagatgggtatcaccgcaatcaag
gaaatattcaggaagtaa

DBGET integrated database retrieval system