KEGG   Desulfovibrio salexigens: Desal_0722Help
Entry
Desal_0722        CDS       T00969                                 

Gene name
frdB
Definition
fumarate reductase iron-sulfur subunit (EC:1.3.99.1)
Orthology
K00245  
fumarate reductase iron-sulfur subunit [EC:1.3.99.1]
Organism
dsa  Desulfovibrio salexigens
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Two-component system
Class
Metabolism; Overview; Carbon metabolism [PATH:dsa01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:dsa00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:dsa00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:dsa00190]
Environmental Information Processing; Signal transduction; Two-component system [PATH:dsa02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
796531..797268
Genome map
AA seq 245 aa AA seqDB search
MSRQLEFDIFRYNPQDKGSVPHMQTFVLDETENMTLFIALNRLREEQDPGLIFDFCCRAG
ICGACAMVVNGKPRLACQTKTVDLPERITLLPLPVYKLIGDLSVDTGVWFREMYQTTESW
IHTTKTFDPNAIEERMENEVAEQIYELERCIECGCCVAACGTARLRDDFLGAASLNRVAR
FVVDPRDQRTDRDYFEIIGNDEGIFGCMGLLGCEDVCPKNLPLQNQLGFLRRKMGITAIK
EIFRK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagcagacaactcgaatttgatatattccgctacaatcctcaggataaggggtcggtt
ccgcacatgcagacctttgtgctggatgaaaccgagaacatgactctgtttattgcgctg
aaccgtttgcgcgaagagcaggaccccggcctgatttttgacttctgttgccgtgccggt
atctgcggtgcctgtgcaatggtggtcaacggtaaaccccgtctggcctgccagaccaaa
acagttgaccttcctgaacgcataaccctgctgcccctgcccgtatataaactgatcggc
gacctttcagttgataccggtgtctggttcagggaaatgtatcagaccacagaatcatgg
attcatactaccaaaacctttgatcccaatgccattgaagagcgtatggagaatgaggtt
gccgagcagatctacgaactggaacgctgcattgaatgcggctgctgtgttgccgcttgc
ggtaccgcacgccttcgtgacgacttcctcggtgctgcatccttgaaccgtgtggcccgt
ttcgtagtcgacccccgcgatcagcgtaccgaccgcgactactttgaaattatcggtaat
gatgaaggtatcttcggctgcatgggcttgctcggctgtgaagatgtctgccccaagaat
cttccgttgcagaaccagctcggtttcctgcgccgcaagatgggtatcaccgcaatcaag
gaaatattcaggaagtaa

DBGET integrated database retrieval system