KEGG   Desulfovibrio salexigens: Desal_0722Help
Entry
Desal_0722        CDS       T00969                                 

Gene name
frdB
Definition
(RefSeq) fumarate reductase iron-sulfur subunit (EC:1.3.99.1)
  KO
K00245  
fumarate reductase iron-sulfur subunit [EC:1.3.5.4]
Organism
dsa  Desulfovibrio salexigens
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Pyruvate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desal_0722 (frdB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Desal_0722 (frdB)
   00620 Pyruvate metabolism
    Desal_0722 (frdB)
   00650 Butanoate metabolism
    Desal_0722 (frdB)
  Energy metabolism
   00190 Oxidative phosphorylation
    Desal_0722 (frdB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Desal_0722 (frdB)
Enzymes [BR:dsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.4  fumarate reductase (quinol)
     Desal_0722 (frdB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
796531..797268
Genome map
AA seq 245 aa AA seqDB search
MSRQLEFDIFRYNPQDKGSVPHMQTFVLDETENMTLFIALNRLREEQDPGLIFDFCCRAG
ICGACAMVVNGKPRLACQTKTVDLPERITLLPLPVYKLIGDLSVDTGVWFREMYQTTESW
IHTTKTFDPNAIEERMENEVAEQIYELERCIECGCCVAACGTARLRDDFLGAASLNRVAR
FVVDPRDQRTDRDYFEIIGNDEGIFGCMGLLGCEDVCPKNLPLQNQLGFLRRKMGITAIK
EIFRK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagcagacaactcgaatttgatatattccgctacaatcctcaggataaggggtcggtt
ccgcacatgcagacctttgtgctggatgaaaccgagaacatgactctgtttattgcgctg
aaccgtttgcgcgaagagcaggaccccggcctgatttttgacttctgttgccgtgccggt
atctgcggtgcctgtgcaatggtggtcaacggtaaaccccgtctggcctgccagaccaaa
acagttgaccttcctgaacgcataaccctgctgcccctgcccgtatataaactgatcggc
gacctttcagttgataccggtgtctggttcagggaaatgtatcagaccacagaatcatgg
attcatactaccaaaacctttgatcccaatgccattgaagagcgtatggagaatgaggtt
gccgagcagatctacgaactggaacgctgcattgaatgcggctgctgtgttgccgcttgc
ggtaccgcacgccttcgtgacgacttcctcggtgctgcatccttgaaccgtgtggcccgt
ttcgtagtcgacccccgcgatcagcgtaccgaccgcgactactttgaaattatcggtaat
gatgaaggtatcttcggctgcatgggcttgctcggctgtgaagatgtctgccccaagaat
cttccgttgcagaaccagctcggtttcctgcgccgcaagatgggtatcaccgcaatcaag
gaaatattcaggaagtaa

DBGET integrated database retrieval system