KEGG   Desulfovibrio salexigens: Desal_0851Help
Entry
Desal_0851        CDS       T00969                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
dsa  Desulfovibrio salexigens
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desal_0851
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Desal_0851
Enzymes [BR:dsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Desal_0851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(952965..954098)
Genome map
AA seq 377 aa AA seqDB search
MSNRIQTLKEAKRIVVKIGSAVLTTAEGINLGLICRLADQLATLHERGVDIVLVSSGAVA
AGRNSIPSGAKLDDLPARQAASAIGQSRLMHEYDETFRRFGLVTSQVLLTRDDLKHRDRF
LNARNTLSRLLEWRVIPIINENDTVAVQELEFGDNDTLASLILNVVEADLFINLTSADGV
FDKNPDKNPDAKPLACIENIHDLDLDAMCDGKTAVGSGGMFSKMRAANRAAQLGVPTLIL
AGKDRMIIERIFNGEERGTWIVPDEKSVSRRKYWLAYHCDPAGDLVIDDGAQKALLSGGK
SLLPAGIIEVDGKFKAGELVRVVNKEGKSLAVGLSCYNSTDIIKIMGCKSCEIESILGKC
PYPEAIHRDNLLLDAAL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaggattcagactcttaaggaagctaaacgcattgttgtaaaaatcgggagt
gcggttctgaccacggctgagggaatcaacctcggcctgatctgccgtcttgccgatcag
ctggcgaccctgcacgaacgcggggtcgacatagtcctcgtctcgtccggtgcggttgct
gccggacgaaactccatcccgtccggcgcaaagctggatgacctgcctgcgcgccaggca
gcctcggccattggtcagtcccggctcatgcatgagtatgacgagactttccgccgtttc
ggtctggtgacctcgcaggttctgcttacccgcgatgacctcaagcaccgcgaccgtttc
ttaaatgcccgcaacaccctttcaagactccttgaatggcgggttatccccatcatcaac
gaaaacgacactgtcgcagttcaggaactggaattcggtgacaacgacaccctcgccagc
ctgatcttaaacgttgttgaagcagatctttttatcaacctcacttctgctgacggtgtt
ttcgacaaaaacccggacaagaaccctgatgcaaagcctctggcctgcattgagaatatc
catgacctcgatctggacgccatgtgcgacggcaagaccgccgttggttccggtggtatg
ttctccaaaatgcgtgcagccaaccgtgcagctcagctcggcgtgccgaccctgatcctt
gcgggcaaagaccgcatgatcattgagcgcatctttaacggcgaagagcgcggtacgtgg
attgtccctgatgaaaaatcagtctcccgccgcaaatactggctggcttaccattgtgac
cccgcaggtgatctcgtcattgacgacggagcacagaaggcactgctttccggaggaaag
agtctgcttcccgcaggcattatagaagtagacggcaaattcaaggccggggagcttgtt
cgagtggttaacaaggaaggcaaatcactggctgttgggttatcatgctataactctaca
gacatcatcaaaattatgggttgcaagtcctgtgagatagagtcgattctcggcaaatgc
ccctaccctgaagcaattcaccgcgataatctgctcttagacgctgctctttaa

DBGET integrated database retrieval system