KEGG   Desulfovibrio salexigens: Desal_0851Help
Entry
Desal_0851        CDS       T00969                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
dsa  Desulfovibrio salexigens
Pathway
dsa00330  Arginine and proline metabolism
dsa00332  Carbapenem biosynthesis
dsa01100  Metabolic pathways
dsa01130  Biosynthesis of antibiotics
dsa01230  Biosynthesis of amino acids
Module
dsa_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Desal_0851
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Desal_0851
Enzymes [BR:dsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Desal_0851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ACS78917
JGI: Desal_0851
UniProt: C6BZ93
Position
complement(952965..954098)
Genome map
AA seq 377 aa AA seqDB search
MSNRIQTLKEAKRIVVKIGSAVLTTAEGINLGLICRLADQLATLHERGVDIVLVSSGAVA
AGRNSIPSGAKLDDLPARQAASAIGQSRLMHEYDETFRRFGLVTSQVLLTRDDLKHRDRF
LNARNTLSRLLEWRVIPIINENDTVAVQELEFGDNDTLASLILNVVEADLFINLTSADGV
FDKNPDKNPDAKPLACIENIHDLDLDAMCDGKTAVGSGGMFSKMRAANRAAQLGVPTLIL
AGKDRMIIERIFNGEERGTWIVPDEKSVSRRKYWLAYHCDPAGDLVIDDGAQKALLSGGK
SLLPAGIIEVDGKFKAGELVRVVNKEGKSLAVGLSCYNSTDIIKIMGCKSCEIESILGKC
PYPEAIHRDNLLLDAAL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaggattcagactcttaaggaagctaaacgcattgttgtaaaaatcgggagt
gcggttctgaccacggctgagggaatcaacctcggcctgatctgccgtcttgccgatcag
ctggcgaccctgcacgaacgcggggtcgacatagtcctcgtctcgtccggtgcggttgct
gccggacgaaactccatcccgtccggcgcaaagctggatgacctgcctgcgcgccaggca
gcctcggccattggtcagtcccggctcatgcatgagtatgacgagactttccgccgtttc
ggtctggtgacctcgcaggttctgcttacccgcgatgacctcaagcaccgcgaccgtttc
ttaaatgcccgcaacaccctttcaagactccttgaatggcgggttatccccatcatcaac
gaaaacgacactgtcgcagttcaggaactggaattcggtgacaacgacaccctcgccagc
ctgatcttaaacgttgttgaagcagatctttttatcaacctcacttctgctgacggtgtt
ttcgacaaaaacccggacaagaaccctgatgcaaagcctctggcctgcattgagaatatc
catgacctcgatctggacgccatgtgcgacggcaagaccgccgttggttccggtggtatg
ttctccaaaatgcgtgcagccaaccgtgcagctcagctcggcgtgccgaccctgatcctt
gcgggcaaagaccgcatgatcattgagcgcatctttaacggcgaagagcgcggtacgtgg
attgtccctgatgaaaaatcagtctcccgccgcaaatactggctggcttaccattgtgac
cccgcaggtgatctcgtcattgacgacggagcacagaaggcactgctttccggaggaaag
agtctgcttcccgcaggcattatagaagtagacggcaaattcaaggccggggagcttgtt
cgagtggttaacaaggaaggcaaatcactggctgttgggttatcatgctataactctaca
gacatcatcaaaattatgggttgcaagtcctgtgagatagagtcgattctcggcaaatgc
ccctaccctgaagcaattcaccgcgataatctgctcttagacgctgctctttaa

DBGET integrated database retrieval system