KEGG   Desulfovibrio salexigens: Desal_1041Help
Entry
Desal_1041        CDS       T00969                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
dsa  Desulfovibrio salexigens
Pathway
dsa00521  Streptomycin biosynthesis
dsa00523  Polyketide sugar unit biosynthesis
dsa01130  Biosynthesis of antibiotics
Module
dsa_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Desal_1041
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Desal_1041
Enzymes [BR:dsa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Desal_1041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ACS79106
JGI: Desal_1041
UniProt: C6C0H2
Position
1163487..1164038
Genome map
AA seq 183 aa AA seqDB search
MKLIETEFPGLVVIEPKVFRDRRGFFLESFNKNVFAENGLPTDFVQDNHAYSSGLGVIRG
LHLQMPPHAQAKLVWVTRGAVNDVVVDLRKGSPTYRRSFKIELSAENFLRLFIPKGFAHG
YETLTEENEFMYKVDSGYAPGSEAGIRWDDPELDIDWKTKNPVLSDKDLELPLLAQFDSP
FEF
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttgattgaaacggaatttcccggacttgtggtcattgaacctaaggtttttagg
gataggcggggcttttttctggaaagtttcaataaaaatgtctttgcggaaaatgggttg
cccactgattttgttcaagacaaccatgcgtattcatcaggtctcggcgtcattcgcggt
ctgcatctgcaaatgcctccgcatgctcaggcaaaacttgtctgggtaacaaggggggct
gttaacgatgtcgttgtggatttgcgtaagggatcaccaacctatcggagatcgttcaaa
attgaactatcagcggagaactttctgaggttgtttatccccaagggatttgcgcatgga
tatgaaactctgaccgaggaaaacgagttcatgtacaaagtcgattctgggtacgccccc
ggcagcgaggccgggatcaggtgggatgatccggaacttgatatcgactggaagacaaag
aatccggtactttccgacaaagacctggagcttcctcttctggcacagtttgactctccg
tttgagttttaa

DBGET integrated database retrieval system