KEGG   Desulfovibrio salexigens: Desal_1041Help
Entry
Desal_1041        CDS       T00969                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
dsa  Desulfovibrio salexigens
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Desal_1041
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Desal_1041
Enzymes [BR:dsa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Desal_1041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1163487..1164038
Genome map
AA seq 183 aa AA seqDB search
MKLIETEFPGLVVIEPKVFRDRRGFFLESFNKNVFAENGLPTDFVQDNHAYSSGLGVIRG
LHLQMPPHAQAKLVWVTRGAVNDVVVDLRKGSPTYRRSFKIELSAENFLRLFIPKGFAHG
YETLTEENEFMYKVDSGYAPGSEAGIRWDDPELDIDWKTKNPVLSDKDLELPLLAQFDSP
FEF
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttgattgaaacggaatttcccggacttgtggtcattgaacctaaggtttttagg
gataggcggggcttttttctggaaagtttcaataaaaatgtctttgcggaaaatgggttg
cccactgattttgttcaagacaaccatgcgtattcatcaggtctcggcgtcattcgcggt
ctgcatctgcaaatgcctccgcatgctcaggcaaaacttgtctgggtaacaaggggggct
gttaacgatgtcgttgtggatttgcgtaagggatcaccaacctatcggagatcgttcaaa
attgaactatcagcggagaactttctgaggttgtttatccccaagggatttgcgcatgga
tatgaaactctgaccgaggaaaacgagttcatgtacaaagtcgattctgggtacgccccc
ggcagcgaggccgggatcaggtgggatgatccggaacttgatatcgactggaagacaaag
aatccggtactttccgacaaagacctggagcttcctcttctggcacagtttgactctccg
tttgagttttaa

DBGET integrated database retrieval system