KEGG   Desulfovibrio salexigens: Desal_1074Help
Entry
Desal_1074        CDS       T00969                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dsa  Desulfovibrio salexigens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dsa00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1194732..1196243)
Genome map
AA seq 503 aa AA seqDB search
MKRSSGVLLHFTSLPSRFGVGDLGPAAYDFADFLAEAGQRFWQVLPITPTAPELCNSPYS
GFSAYAANPLLISPELMVDYGLLEYEDILQHTLPDTDHADFETAGMVKEELLRKAFARVA
NNLLDEVIFNQFIWDNMHWINDFALFTALKKHFKGASWVTWPEDIRDRTEDGLRHWGEKL
YREILYVKFCQWIFFRQWGQLKDHLDEIGVELIGDVPIYVTHDSSDVWANRNIFKLDNKG
EAYCVAGVPPDYFSEKGQLWGNPVYNWEVLQNDGFGWWISRMKHNLGLYHWVRLDHFRGF
SAYWEVPAEAETAMEGYWVPAPGHQLFEKLTEEIGCLRIIAEDLGHITPDVIWLKDRFQL
PGMNILQFSFGEDIGYCGDALHNHKRNSVVYTGTHDNNTNRGWFLEDADEVSRKNLLAYL
GYNWIDDVKISWELIRLLMSSVGCLCVIQAQDLLSLDGKARMNVPGEADGNWGWKLTPGQ
LTPLIRERLGEMTELFGRTSKID
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgttccagcggtgttcttttacacttcacttcactgccttcccggttcggtgtc
ggtgatcttggtccggcggcttacgattttgccgactttctagcagaagccggacaaaga
ttctggcaggtactgcccattactcctacagcgccggagctctgcaactctccatattcc
ggattttccgcttatgcggccaatccgctattgatcagcccggaactcatggttgattac
ggtctgctggaatatgaagatattctacagcacaccctccccgacaccgatcatgctgat
ttcgagacagcaggaatggttaaggaagaattgctccgcaaagctttcgcacgggtagcc
aacaatctcctcgatgaagtgatcttcaaccagtttatctgggacaatatgcactggatt
aacgattttgccctttttacagccttgaaaaagcatttcaaaggcgcaagctgggtcact
tggcctgaagatatacgcgaccggacagaagacggcctgcggcattggggtgaaaagctc
taccgcgaaattctgtacgtaaaattctgccaatggattttcttccgccaatgggggcaa
ctcaaagaccatcttgatgaaatcggggtcgaacttattggagacgtccctatctacgtt
acccacgacagttccgatgtctgggccaaccgtaatatttttaagctcgacaataaaggc
gaggcgtattgtgttgccggggtcccgccggattatttcagcgaaaaaggccagctatgg
ggtaatccggtctacaattgggaagtactccaaaatgacggcttcggctggtggatcagc
cgcatgaagcacaatctaggtctttaccattgggtgcgccttgaccacttccgaggcttc
tcagcatattgggaagttcctgccgaagctgagacagccatggaaggttactgggtcccc
gcgcccggtcatcaactttttgaaaaactcactgaagaaataggatgtctgcgaattatt
gccgaagatcttggtcatataacacccgatgtaatatggcttaaggaccgcttccagctt
ccgggcatgaacatcctgcaattctcctttggagaagacatcggctattgcggagatgcc
ctgcacaaccataagcgcaattctgtagtctacaccggaactcacgacaacaataccaat
aggggatggtttctcgaagatgctgatgaagtcagtcgtaaaaatctgctagcctacctc
ggctacaattggatagatgatgtcaagatttcatgggaattgatcagactgcttatgtcc
agcgtaggctgcttgtgcgtaattcaggcacaggacctgctcagccttgacggaaaggct
cgtatgaatgtccccggcgaggctgacggcaactggggatggaaacttacccccggacag
ctgaccccgcttatccgtgaaaggctgggggaaatgaccgaactttttggccgcaccagc
aagattgactag

DBGET integrated database retrieval system