KEGG   Desulfovibrio salexigens: Desal_1082Help
Entry
Desal_1082        CDS       T00969                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dsa  Desulfovibrio salexigens
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:dsa00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1204402..1206273)
Genome map
AA seq 623 aa AA seqDB search
MCGIAGYFNPGGHPGDIKPILDLISHRGPDFQHIHTEESIALGHTRLSILDLSDRGNQPM
KDLKTGNIIVFNGEIYNFKSLREELIGKGHTFNSSGDTEVLLKLYGEYGEKCISMLRGMF
AFAIWDNSKKQLFIARDRLGKKPFFYSQSGNSFIFASEIRALAAHPDISKDVDVQAIDLF
MSTGCVPSPFSIYSDIRKLPAAHYGIVNAQGLSLHRYWSLDFTQKIECSEEDVLESLHSR
LLEATRIRLESDVPLGALLSGGVDSSLVVALMAEAGSKSIDTFTIGFHEKKYDESGHAAK
VAKHLGVNHHVEYLDPTQFENMLPAVVRQYGEPFSDDAALATMLLSEATRKHVTVALSGD
GGDELACGYSAYTHVKLASALAPMIGKKILPEKNIASAFNSNSALGKLRRKMICKFHPEF
KRILRNEFKVARYKNDVFRADVQEQLGQFNFKWQYELSRQACIHAKTPAERLLWMDTVHF
LADALLVKVDIASMAHSLEVRSPLLDHELFEYMASLPPELKIKGGESKYLLKKLAERYLP
KDILYRRKQGFSMPVAKWTSGDSADFTLDAISQAKPFLLQFFDMNALNKRIDEHISGRKK
HKNFVWNILNLALWAIEHKNGRV
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcattgcaggctatttcaatcccggtggacatcccggagacattaaacccatc
ctcgaccttatttcccatcgaggcccagactttcagcacatccacacagaggaaagcatc
gcactgggacatacccggctctctattctcgacctttccgatcgaggcaaccagcccatg
aaagatttgaaaaccgggaacatcattgtcttcaacggggaaatatacaatttcaaatcc
ctgcgcgaagagttgataggcaaaggacacaccttcaattcatccggagatacggaagtt
ctgctcaagctttacggtgaatacggagaaaaatgcatttctatgctgcgcggcatgttt
gcattcgccatctgggacaactccaaaaagcaactgttcatcgcacgcgaccgcctcggt
aaaaaaccattcttttactctcaaagcggtaacagtttcatctttgcttccgagattcgt
gctcttgcagctcaccctgatatttcaaaggacgtggacgtacaggccattgaccttttc
atgagtaccggatgcgttccatcccccttttccatctactcagacataagaaagctccct
gccgcccattacggcattgtgaatgctcagggactttctctgcatcgctattggtccctt
gatttcacccaaaaaattgaatgttcggaagaagatgtactggaatcactgcacagccga
cttctggaggcaaccagaatcaggctggagagtgatgttccgctgggagccctgctttca
ggcggggtcgattccagccttgtcgtggcacttatggctgaagccggaagtaaatctatc
gacaccttcaccatcggttttcatgagaagaaatatgatgagtcaggccatgcagccaaa
gtagcaaagcatctgggtgtgaatcatcatgtggaatatctggacccgacccaatttgag
aatatgctgcccgcagtagtccggcaatacggtgaacctttttcggatgacgcagctttg
gcaaccatgctgctcagtgaagccacccgcaaacacgttaccgttgccctcagcggtgat
ggaggcgatgaactggcctgtgggtactctgcatacacccatgtgaaattggcttcggct
ttagcacctatgatcggtaaaaaaattctgccggaaaagaatatcgccagcgccttcaac
agcaattcggcacttggtaaactgcgccgtaagatgatctgtaaattccaccctgaattt
aaacgcatactgcgtaatgaattcaaggtcgcccgctataagaatgatgtcttccgcgct
gatgttcaggaacagctggggcaatttaattttaaatggcagtacgaactttcccggcag
gcctgtatacacgcaaaaactcccgcagaacgactgctctggatggacaccgtccatttc
ctcgctgacgcactgctggtgaaggtggatattgcttccatggctcacagccttgaagtg
cgttctccgctgcttgatcatgaacttttcgagtacatggcaagcctgccccctgaactt
aaaatcaagggcggcgagtcaaaatacctgctcaaaaaacttgcagaacgctacctgccc
aaggatatcctttaccgccgcaagcagggtttctccatgcctgttgctaaatggaccagc
ggcgattcagccgacttcacacttgatgctatcagtcaggctaaacctttcctgctgcag
tttttcgatatgaacgcgctgaacaaacgaattgatgagcatatatcaggaaggaaaaag
cacaaaaattttgtctggaatatattaaatctggcactctgggccattgagcataaaaac
ggcagagtctag

DBGET integrated database retrieval system