KEGG   Desulfovibrio salexigens: Desal_1089Help
Entry
Desal_1089        CDS       T00969                                 

Definition
glycoside hydrolase family 3
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
dsa  Desulfovibrio salexigens
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Desal_1089
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Desal_1089
Enzymes [BR:dsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Desal_1089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1211606..1212727
Genome map
AA seq 373 aa AA seqDB search
MRKIIFILMFILAISSGCSLKTNTSNPSELDIMIGQMVMVGFRGLELSANNPVVGDIRDA
RVGGVILFSKDCALNSTVRNIASSSQLIKLTSDLQSYAQVPLFISIDQEGGIIKRLTGEM
GFPETPSAAELGNSGDTQAAFRAGKTIGKSLKEAGINMNFAPVVDVNRNAANPVIAALQR
SFSDDPRIVARFADSYIDGLHSEGIISCLKHFPGHGSSRGDSHLGFTDVTDSWDSSELYP
FQKLISDNKADMVMTAHIFNARWDRKYPATLSRNVIHGLLRRKLGFEGIIVTDDMQMQAV
SGEYGFKEGVYRAVKAGADILLFGNNLIYEPGLGTKAVSTLKQLVHEGKITERRIRQSYD
RIMREKQGMGAAN
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
ttgagaaaaataatatttattttaatgtttattcttgcgatttccagcggatgttcgctt
aagacaaatacttccaacccttctgaattagacatcatgatcggtcagatggtcatggtc
ggattccggggattggaattgagtgcgaataatccggttgtgggcgatatcagggatgcc
cgtgtcgggggagtaattctcttcagcaaggattgcgctttgaatagcacagtacgcaat
attgcaagctcttctcaactgataaagcttacttcggatctgcaaagttatgctcaagtt
ccgttgttcatctcgattgatcaggaaggcggcataattaaaagattgaccggagaaatg
ggttttccggaaactccgtccgccgctgagctgggaaacagcggtgatactcaggctgca
ttcagggctgggaagactatcggaaagtcattaaaagaagccggaattaatatgaatttc
gctccggttgtggatgtgaaccgtaatgcagctaatccggtgattgcagccttacagcgc
agtttttcagatgatccacgcattgtggcccgatttgcagattcatatattgacggcctg
catagcgaaggcattatttcatgtctgaaacattttccgggacatggcagttcccgcggt
gattcacatttaggttttaccgatgtgactgattcatgggacagcagcgaactttatcct
tttcagaaattaatcagcgataataaagctgatatggtcatgaccgcgcatattttcaat
gcccgctgggaccgcaagtatccggcaactctttcccgtaatgttattcacggtcttctg
cgccgtaagcttggtttcgaaggcataattgttaccgatgatatgcagatgcaggctgtt
agcggagagtatggtttcaaggaaggcgtctacagggcggtaaaggccggggccgatatt
cttcttttcggcaataatctgatttatgaacccggtttgggaaccaaggcagtttcaact
ctcaaacagcttgttcatgagggaaagatcaccgaacgtagaatccggcagtcctatgac
cgtatcatgcgtgagaagcaggggatgggagctgcaaattaa

DBGET integrated database retrieval system