KEGG   Desulfovibrio salexigens: Desal_1145Help
Entry
Desal_1145        CDS       T00969                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
dsa  Desulfovibrio salexigens
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Desal_1145
Enzymes [BR:dsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Desal_1145
Transfer RNA biogenesis [BR:dsa03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Desal_1145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1277646..1278401)
Genome map
AA seq 251 aa AA seqDB search
MEEIIKNLSCIAREAGAAIMAVRNKGFDVKNKNDKSPVTEADIASNEVISKRLKELYPEI
PILSEEGTKIPYEERKQWDIFFLIDPLDGTKEFIKDNGEFCVCIALMRKKRPILGVVYAP
TQDALYTGSIETGAQVSKNGEPPVAISTRPPAENEGLIVVGSRSHPAPELADYLETLNVE
KMTPAGSAIKFCLVAEGKAHLYPRFNPTMEWDTGAGQAIVEAAGGSMLGLDGKEFPYNKE
NLRNAGFIVKA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaataatcaagaatctatcctgtattgcacgcgaagccggagctgctatcatg
gctgtccgtaataaaggctttgacgtgaaaaacaagaatgataaatcacctgttactgaa
gctgacattgcctcaaacgaagtgatttccaaacgtctgaaagaactatatccagaaata
cccatattatcggaagagggaaccaaaataccctacgaagaaagaaaacaatgggatatt
tttttcctcatagatccattggacggcactaaagagtttatcaaggacaatggtgaattc
tgcgtatgcatagcactgatgcgtaagaaacgcccgattctgggagtagtctacgcccca
actcaggacgcgctctataccggaagcatcgaaactggagcacaggttagcaaaaacggc
gaacctcctgtagccatatccacccgtcctccagctgaaaacgaaggactaatcgtggtc
ggaagcaggtcacaccctgcaccggaacttgcggattatctggaaactctcaacgtggaa
aaaatgactcctgcgggcagtgctataaaattctgccttgttgctgaaggcaaagcacat
ctttacccacgctttaaccctaccatggaatgggatacgggagcagggcaagctattgtt
gaggctgcgggcggctccatgcttggactggatgggaaggaattcccttacaacaaagaa
aatttgagaaatgcaggcttcattgtcaaagcctga

DBGET integrated database retrieval system