KEGG   Desulfovibrio salexigens: Desal_1145Help
Entry
Desal_1145        CDS       T00969                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
dsa  Desulfovibrio salexigens
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:dsa00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1277646..1278401)
Genome map
AA seq 251 aa AA seqDB search
MEEIIKNLSCIAREAGAAIMAVRNKGFDVKNKNDKSPVTEADIASNEVISKRLKELYPEI
PILSEEGTKIPYEERKQWDIFFLIDPLDGTKEFIKDNGEFCVCIALMRKKRPILGVVYAP
TQDALYTGSIETGAQVSKNGEPPVAISTRPPAENEGLIVVGSRSHPAPELADYLETLNVE
KMTPAGSAIKFCLVAEGKAHLYPRFNPTMEWDTGAGQAIVEAAGGSMLGLDGKEFPYNKE
NLRNAGFIVKA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaataatcaagaatctatcctgtattgcacgcgaagccggagctgctatcatg
gctgtccgtaataaaggctttgacgtgaaaaacaagaatgataaatcacctgttactgaa
gctgacattgcctcaaacgaagtgatttccaaacgtctgaaagaactatatccagaaata
cccatattatcggaagagggaaccaaaataccctacgaagaaagaaaacaatgggatatt
tttttcctcatagatccattggacggcactaaagagtttatcaaggacaatggtgaattc
tgcgtatgcatagcactgatgcgtaagaaacgcccgattctgggagtagtctacgcccca
actcaggacgcgctctataccggaagcatcgaaactggagcacaggttagcaaaaacggc
gaacctcctgtagccatatccacccgtcctccagctgaaaacgaaggactaatcgtggtc
ggaagcaggtcacaccctgcaccggaacttgcggattatctggaaactctcaacgtggaa
aaaatgactcctgcgggcagtgctataaaattctgccttgttgctgaaggcaaagcacat
ctttacccacgctttaaccctaccatggaatgggatacgggagcagggcaagctattgtt
gaggctgcgggcggctccatgcttggactggatgggaaggaattcccttacaacaaagaa
aatttgagaaatgcaggcttcattgtcaaagcctga

DBGET integrated database retrieval system