KEGG   Desulfovibrio salexigens: Desal_1253Help
Entry
Desal_1253        CDS       T00969                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
dsa  Desulfovibrio salexigens
Pathway
dsa00900  Terpenoid backbone biosynthesis
dsa01100  Metabolic pathways
dsa01110  Biosynthesis of secondary metabolites
dsa01130  Biosynthesis of antibiotics
Module
dsa_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Desal_1253
Enzymes [BR:dsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Desal_1253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Semialdhyde_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ACS79316
JGI: Desal_1253
UniProt: C6C1S0
Position
complement(1376986..1378188)
Genome map
AA seq 400 aa AA seqDB search
MQTYISPWPAKATLPDFPRSISILGSTGSIGTSTLKVIEQHPDLFKVTALAGARNAKLLA
EQAIKHRPQYLAVLNDEAAAELKSLLPADYKPEILTGPSAYITLAELEEVSVVLSSIVGA
AGFEPTLAAAKKGKMIALANKESLVLGGHIIRDECHRTGATILPVDSEHNALFQGLAGHD
GEEVSRLILTASGGPFRGKSKEFLETVTREQALAHPNWDMGAKISIDSATLMNKGLEFIE
ACHLYGLPPEQVDVVVHPQSIIHSLVEYVDGSQLGHLGVPDMQIPIAFCMCFPQRVPLKL
KQLNLAEVGTLTFEKPDLEVFPCLKHAADSFSAGQSHPIVLNAANEVAVDLFLKEKIRFL
DIPAIIGKALESHAGCDVSEAGAVLELDIKTRRDVMESIV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaacatatatttccccatggccggcaaaagcgacattaccggatttccccagatca
atttccattctgggcagcaccggctctatcggaaccagcacccttaaggtaattgagcag
cacccggatcttttcaaggtaaccgcccttgccggagcaagaaatgcaaagctgctggca
gagcaggctattaaacatcgcccccagtacctggctgtacttaacgatgaagctgctgct
gaactgaaaagcctgcttcctgctgattacaaaccggaaatcctgaccgggccttccgct
tacatcacccttgctgaactggaagaagtgtctgttgtcctttcatccattgtcggggcc
gcaggttttgagcccactcttgccgctgccaagaaaggaaaaatgatagctcttgcaaac
aaggaatcccttgtgctcggcggccatatcatccgcgatgaatgccaccgcaccggtgca
accatccttccggtagactctgagcataacgcactttttcaggggcttgccggacacgat
ggcgaagaagtaagcagacttattctgacagcttccggcggaccgttccgtggcaaatca
aaagaatttctcgaaacagtaacacgcgaacaggctctggcccaccccaactgggacatg
ggcgcaaaaatcagcattgattccgcaaccctcatgaataaggggctggaattcattgaa
gcctgccacctctacggcctgccgccggaacaggtggatgttgtggttcacccccagtcc
ataatccactctttggttgagtatgtggacggttcacagcttggacaccttggcgtaccg
gacatgcagatccccattgctttctgcatgtgcttcccccagcgcgtccccttgaagctc
aaacagctgaacctcgcagaggtaggcaccctgacctttgaaaagccggatcttgaagtc
ttcccctgcctgaaacatgcagcggattctttctcagccggacagagtcatcctattgtc
ctcaacgcagcaaatgaagtagcggtcgaccttttcctgaaagaaaagatccgctttctg
gacattccggccattatcggcaaggcactggaaagccatgccggatgtgatgtaagcgaa
gctggagcagtccttgaactggatatcaaaaccagacgagatgtgatggaatccatcgtc
taa

DBGET integrated database retrieval system