KEGG   Desulfovibrio salexigens: Desal_1318Help
Entry
Desal_1318        CDS       T00969                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
dsa  Desulfovibrio salexigens
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Desal_1318
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desal_1318
  Lipid metabolism
   00071 Fatty acid degradation
    Desal_1318
  Amino acid metabolism
   00350 Tyrosine metabolism
    Desal_1318
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Desal_1318
   00626 Naphthalene degradation
    Desal_1318
Enzymes [BR:dsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Desal_1318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1447426..1448613)
Genome map
AA seq 395 aa AA seqDB search
MLNFQIFIPTRIVFGPGKLAELGTLPLPKGKKAMVVIGESGAMIENGYLDKVQALLAKQN
ISTVVFDNISPNPKSDQVDEAAKIAREKGIDFIVALGGGSTIDASKAIALLTTNVGKCWD
YMQAGSGGGVNPENPAAPLIAIPTTAGTGTEADQWAVINKSGGIEKISLGNDSTFPTISI
VDPELMVSVPPRTTAYTGIDTFFHAVETFLSTAHQPMSDMLALEAVHLSSHYLPMAIAEG
DNIEARTVMAWSSTAAGMCETLSRCISQHALEHALSAKYPDLPHGLGLAKLSVPYFKRLI
PESPERFEDLAMAMGYDTQQFDENMRATVFLEGLRSLLERAGFNEESLKDYGAKEEDVAE
LVEIAEQTMGKLFEFTPAKMEREDLECIMSEAIAG
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgctcaattttcaaatatttattcccacccgcattgttttcggtcccggcaaacttgct
gaactcggcaccctgcccctgcccaaaggcaaaaaagcaatggttgtcatcggtgaatcc
ggtgcaatgatcgagaacggttacctcgacaaagtgcaggctctcctcgccaagcagaat
atttccacagtggttttcgataacatctcccccaacccgaaatcagatcaggttgacgag
gctgcaaaaatcgcccgtgaaaaaggaatcgactttatcgttgcacttggcggcggttcc
accattgatgcttccaaagctatcgctcttttgaccaccaacgtgggcaaatgctgggat
tacatgcaggccggttccggcggcggagttaatcctgaaaacccggcagcaccgctcatc
gccatccccaccacagcgggaacaggaaccgaagcggaccagtgggcagtgatcaacaaa
tccggcggcattgaaaaaatcagcctcggtaatgattccaccttcccgaccatctccatc
gttgacccggaactcatggtcagcgtgcccccgcgcacaacagcctataccggtatcgac
acatttttccatgcagtggaaaccttcctttccacagcacaccagcccatgagcgacatg
ctggccctcgaagcggttcacctgagcagccattacctgcccatggcaattgccgaaggc
gacaacatcgaagcccgcacagtcatggcatggtccagcactgccgcaggtatgtgcgag
actctttcccgctgcatttcccagcatgctcttgaacatgccctgagcgcaaaatatcca
gatctcccgcacggcctcggccttgccaagctttccgtgccctatttcaaacgcctgatc
ccggaaagcccggaacgtttcgaagatctcgccatggcaatgggttacgatacccagcaa
tttgacgagaacatgcgcgcaacagtcttcctcgaaggcctgcgttccctgctcgaacgg
gccggattcaacgaagaatcgctcaaagattatggtgcaaaggaagaagacgttgccgag
ctggtagagatcgcagagcagactatgggcaaactcttcgagttcacccccgctaaaatg
gaacgcgaagatctcgaatgcatcatgtccgaagctattgcgggatag

DBGET integrated database retrieval system