KEGG   Desulfovibrio salexigens: Desal_1598Help
Entry
Desal_1598        CDS       T00969                                 

Definition
diaminopimelate aminotransferase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
dsa  Desulfovibrio salexigens
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dsa01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:dsa00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1748833..1750053)
Genome map
AA seq 406 aa AA seqDB search
MPTQLLSKIDDMKDAALDLHAKLVAIPAIGPTNNGTGEKAKADFLTEYLKENGFGEVKSY
NAPDDRVECGYRPNLVTVIPGQDRSRTLWIISHMDVVPVGDLSLWDTDPFKMVQDGDTIY
GRGVEDNHQGLVSSVIAAKALLDSGLTPGINIGLIFVSDEETGSHYGLEYIVKEHEDLFK
KNDLFLVPDSGEPDSALVEIAEKSSVWFKVTVEGKQCHASTPEQGVNSLVAAAAMIMEVP
ELKYHFDEEDELFSPPFSTFEPTKKEANVENINTIPGKDVFYIDCRVLPTYDLKEVIDQV
KGMGLYVAEEYGVKVTVEVESESQAAPPTPADAEIVEKVVDAVKEVYGVDARAGGIGGGT
VAAHLRERGYQTVVWSTLLHQAHQPNEKGSISNTLNDAKVMALLPF
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcctactcagcttctttcaaaaattgacgacatgaaagacgcagctctcgacctccac
gccaagctggttgccattcctgccataggtcccaccaacaatggaaccggggaaaaggcc
aaagcggacttcctgaccgaataccttaaagaaaacggattcggcgaagtcaaatcatac
aatgcgccggatgatagagttgagtgcggttacagacccaatctggttactgtaattccc
ggtcaggatcgttccagaaccctctggatcatttcccatatggatgttgttcctgtagga
gatctcagcctctgggatactgatccgtttaaaatggtacaggatggtgacacaatttac
gggcgcggtgtggaagacaaccatcagggtttggtgagttccgttattgctgcaaaagcc
ctgcttgattccggtctgaccccgggtatcaatatcggactcatcttcgtttccgatgaa
gaaacaggttctcattacggccttgaatacatcgtcaaagaacacgaagacctgttcaag
aaaaacgaccttttcctcgttcctgattccggcgaaccggattcagcactggttgaaatt
gcggaaaaatcatccgtatggttcaaggtgacagtggaaggcaaacagtgccacgcatcc
actcccgaacagggtgtgaactctcttgtagctgctgccgcaatgatcatggaagtgccg
gaactgaaatatcattttgatgaagaagacgaacttttctccccgcccttctccactttc
gagcctactaaaaaagaggccaacgttgagaacatcaacaccattccgggcaaagatgtt
ttctacatcgactgccgtgtgctgcccacttacgacctgaaagaagtaattgatcaggtc
aaaggcatgggtctttacgttgccgaagagtacggcgtaaaagtcacagtggaagttgaa
agcgaaagtcaggctgcaccgcctaccccggctgatgccgagatcgtggaaaaagttgtc
gatgccgttaaggaagtttatggcgttgatgccagagccggcggaatcggcggcggaaca
gttgctgcccacctgcgcgagcgcggctaccagacagttgtctggtccaccctgctgcat
caggcccaccagcccaatgaaaaaggttccatcagcaacactctcaatgatgcgaaagta
atggcacttctgcctttctag

DBGET integrated database retrieval system