KEGG   Desulfovibrio salexigens: Desal_1794Help
Entry
Desal_1794        CDS       T00969                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
dsa  Desulfovibrio salexigens
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Desal_1794
Enzymes [BR:dsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Desal_1794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1970993..1971835
Genome map
AA seq 280 aa AA seqDB search
MSRNYSWTIKGGRVLGPAPFFIAGIVNVTPDSFYDGGKNYDPQQAIEHGRQLAKQGADIL
DVGGESTRPFADPVSLDDELSRVIPVISELSRDYVVSVDTVKSEVARKAVEAGAAIVNDV
SAFAQDPALLDVVADLKPGYVLMHSQGTPEEMQLSPTYDNVIEDILSFFEKSLEKLIKSG
LPENRIVLDPGIGFGKTLNHNLEILRRIDRFMGLGFPIYMGLSNKSLWGKLLGLEAGERQ
NATQAATAVLAARGVPIHRVHEVGLTSQTLRIVKEIGGDN
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtaattattcatggacaattaaaggggggagggtgttaggccctgcccctttt
tttattgccggtattgttaatgtcacccctgactctttttatgacgggggaaagaattat
gatccgcagcaggctatagaacatggccgccagctcgcaaaacagggcgcggatatcctc
gatgtaggcggtgaaagtacaaggccctttgcagatcctgtttcgcttgatgatgaattg
tctcgcgtaattcccgttatcagtgaactcagtcgtgattatgtagtatcggttgatacg
gttaagagtgaagttgccagaaaggccgttgaggccggagcggctatagttaatgatgtt
tccgcctttgctcaagacccggcactgcttgatgttgttgctgatctcaaacccggttac
gttcttatgcatagtcagggaaccccggaagagatgcaattgtcgccgacttatgataat
gtcatagaggatattttgagtttttttgaaaaaagtcttgaaaaactcataaagtcaggc
ttaccggaaaatcgaatagtacttgatcccggcattggttttggaaagacacttaaccac
aatcttgagattttacgcaggattgaccgatttatgggtttgggatttcctatatatatg
ggactttcaaataagtctttgtggggcaagttactgggtctggaagctggagagagacaa
aatgcaactcaggcagcaaccgctgtccttgctgcccggggagttcctattcaccgggtg
catgaagtcggcctgaccagccagacattgagaatagtgaaggagatcggcggagataat
tga

DBGET integrated database retrieval system