KEGG   Desulfovibrio salexigens: Desal_1794Help
Entry
Desal_1794        CDS       T00969                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
dsa  Desulfovibrio salexigens
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dsa00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1970993..1971835
Genome map
AA seq 280 aa AA seqDB search
MSRNYSWTIKGGRVLGPAPFFIAGIVNVTPDSFYDGGKNYDPQQAIEHGRQLAKQGADIL
DVGGESTRPFADPVSLDDELSRVIPVISELSRDYVVSVDTVKSEVARKAVEAGAAIVNDV
SAFAQDPALLDVVADLKPGYVLMHSQGTPEEMQLSPTYDNVIEDILSFFEKSLEKLIKSG
LPENRIVLDPGIGFGKTLNHNLEILRRIDRFMGLGFPIYMGLSNKSLWGKLLGLEAGERQ
NATQAATAVLAARGVPIHRVHEVGLTSQTLRIVKEIGGDN
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtaattattcatggacaattaaaggggggagggtgttaggccctgcccctttt
tttattgccggtattgttaatgtcacccctgactctttttatgacgggggaaagaattat
gatccgcagcaggctatagaacatggccgccagctcgcaaaacagggcgcggatatcctc
gatgtaggcggtgaaagtacaaggccctttgcagatcctgtttcgcttgatgatgaattg
tctcgcgtaattcccgttatcagtgaactcagtcgtgattatgtagtatcggttgatacg
gttaagagtgaagttgccagaaaggccgttgaggccggagcggctatagttaatgatgtt
tccgcctttgctcaagacccggcactgcttgatgttgttgctgatctcaaacccggttac
gttcttatgcatagtcagggaaccccggaagagatgcaattgtcgccgacttatgataat
gtcatagaggatattttgagtttttttgaaaaaagtcttgaaaaactcataaagtcaggc
ttaccggaaaatcgaatagtacttgatcccggcattggttttggaaagacacttaaccac
aatcttgagattttacgcaggattgaccgatttatgggtttgggatttcctatatatatg
ggactttcaaataagtctttgtggggcaagttactgggtctggaagctggagagagacaa
aatgcaactcaggcagcaaccgctgtccttgctgcccggggagttcctattcaccgggtg
catgaagtcggcctgaccagccagacattgagaatagtgaaggagatcggcggagataat
tga

DBGET integrated database retrieval system