KEGG   Desulfovibrio salexigens: Desal_1798Help
Entry
Desal_1798        CDS       T00969                                 

Definition
(GenBank) Nucleotidyl transferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dsa  Desulfovibrio salexigens
Pathway
dsa00040  Pentose and glucuronate interconversions
dsa00052  Galactose metabolism
dsa00500  Starch and sucrose metabolism
dsa00520  Amino sugar and nucleotide sugar metabolism
dsa01100  Metabolic pathways
dsa01130  Biosynthesis of antibiotics
Module
dsa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Desal_1798
   00052 Galactose metabolism
    Desal_1798
   00500 Starch and sucrose metabolism
    Desal_1798
   00520 Amino sugar and nucleotide sugar metabolism
    Desal_1798
Enzymes [BR:dsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Desal_1798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 IspD SpoVAE
Motif
Other DBs
NCBI-ProteinID: ACS79860
JGI: Desal_1798
UniProt: C6BTT0
Position
1974937..1975806
Genome map
AA seq 289 aa AA seqDB search
MVIKKVIVPVAGWGTRSLPATKNIPKEMLPIFKKPVVQHVVEEAMSSGLTDVVFINNQNK
KIIEDHFDYNLSLEDVLERGGKTEALEEVRKVAEMVNIISVRQKKQLGLGHAVLCAKEVC
KNDPFAVMVGDDLMFGMEPGIKQLIDAARTENMAVVGVIEVPENKVNRYGIIQGEEFAPG
MYRVRSLVEKPAIGQAPSRLAIVGRYVLLPEIFDHLESLEPGVGGEIQLTDALQGLAQDN
KLLAVKLRGQRFDAGDWVDYLTANIYFALQDEGLRDDVVARLRELLSCS
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggtcatcaagaaagttattgttccggttgctggatggggtacaagatcattgcctgcc
accaagaacattcccaaggaaatgctgcctattttcaaaaagccggttgtgcagcatgtg
gtggaagaggccatgtccagtggactgaccgatgttgttttcattaacaaccagaacaaa
aagatcattgaagaccactttgactacaacctctctcttgaagacgtgcttgagcgcggc
ggcaagaccgaagcccttgaggaagttagaaaggttgcggagatggttaacatcatttcc
gtacgccagaaaaaacagcttggtcttgggcatgcagttctctgtgccaaggaagtctgc
aaaaacgatccctttgccgtaatggtcggtgatgacctcatgttcggtatggagccgggt
atcaagcagctcattgatgctgcccgtactgaaaatatggctgttgtcggcgttattgaa
gttcctgagaacaaggttaaccgttacggtattattcagggtgaagagttcgctccggga
atgtatcgtgttcgctctctggttgaaaaaccggctatcggtcaggctccttcaagactg
gcaattgtcggacgctatgtcctgctgcctgaaatctttgatcatctggaaagccttgag
cccggtgtaggtggagagattcagctcactgatgctttgcagggactcgctcaggataac
aaactgctggccgtgaaacttcgcggacaaaggtttgacgccggggactgggtagattat
cttaccgcaaatatttacttcgcccttcaggacgaggggctgcgtgatgacgttgtagcc
agattgcgggagcttttgtcttgttcgtaa

DBGET integrated database retrieval system