KEGG   Desulfovibrio salexigens: Desal_1798Help
Entry
Desal_1798        CDS       T00969                                 

Definition
nucleotidyl transferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dsa  Desulfovibrio salexigens
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:dsa00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dsa00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dsa00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dsa00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1974937..1975806
Genome map
AA seq 289 aa AA seqDB search
MVIKKVIVPVAGWGTRSLPATKNIPKEMLPIFKKPVVQHVVEEAMSSGLTDVVFINNQNK
KIIEDHFDYNLSLEDVLERGGKTEALEEVRKVAEMVNIISVRQKKQLGLGHAVLCAKEVC
KNDPFAVMVGDDLMFGMEPGIKQLIDAARTENMAVVGVIEVPENKVNRYGIIQGEEFAPG
MYRVRSLVEKPAIGQAPSRLAIVGRYVLLPEIFDHLESLEPGVGGEIQLTDALQGLAQDN
KLLAVKLRGQRFDAGDWVDYLTANIYFALQDEGLRDDVVARLRELLSCS
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggtcatcaagaaagttattgttccggttgctggatggggtacaagatcattgcctgcc
accaagaacattcccaaggaaatgctgcctattttcaaaaagccggttgtgcagcatgtg
gtggaagaggccatgtccagtggactgaccgatgttgttttcattaacaaccagaacaaa
aagatcattgaagaccactttgactacaacctctctcttgaagacgtgcttgagcgcggc
ggcaagaccgaagcccttgaggaagttagaaaggttgcggagatggttaacatcatttcc
gtacgccagaaaaaacagcttggtcttgggcatgcagttctctgtgccaaggaagtctgc
aaaaacgatccctttgccgtaatggtcggtgatgacctcatgttcggtatggagccgggt
atcaagcagctcattgatgctgcccgtactgaaaatatggctgttgtcggcgttattgaa
gttcctgagaacaaggttaaccgttacggtattattcagggtgaagagttcgctccggga
atgtatcgtgttcgctctctggttgaaaaaccggctatcggtcaggctccttcaagactg
gcaattgtcggacgctatgtcctgctgcctgaaatctttgatcatctggaaagccttgag
cccggtgtaggtggagagattcagctcactgatgctttgcagggactcgctcaggataac
aaactgctggccgtgaaacttcgcggacaaaggtttgacgccggggactgggtagattat
cttaccgcaaatatttacttcgcccttcaggacgaggggctgcgtgatgacgttgtagcc
agattgcgggagcttttgtcttgttcgtaa

DBGET integrated database retrieval system