KEGG   Desulfovibrio salexigens: Desal_1936Help
Entry
Desal_1936        CDS       T00969                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dsa  Desulfovibrio salexigens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desal_1936
   01230 Biosynthesis of amino acids
    Desal_1936
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desal_1936
   00051 Fructose and mannose metabolism
    Desal_1936
   00562 Inositol phosphate metabolism
    Desal_1936
Enzymes [BR:dsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Desal_1936
Exosome [BR:dsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Desal_1936
  Exosomal proteins of bladder cancer cells
   Desal_1936
  Exosomal proteins of melanoma cells
   Desal_1936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2120130..2120885
Genome map
AA seq 251 aa AA seqDB search
MKKLMAANWKMYKTRAEAKATAEDLLTKIEGKLPADREVVIAAPYTALETVGSVLAGNAD
CHLSAENLYPKAEGAFTGEISPAMLKDVGCVYSLAGHSERRAIIGETDELVGDKVAFGLE
NGLSMILCIGETIDERKAGEVQKVIDEQLEAGLKNVASDFAPETVVVAYEPVWAIGTGEV
AGEGEIVEAHGFVREKLKKLFPEKANEIRILYGGSVKPANCAQIIALDNVDGVLVGGASL
DAESFSQIALA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaatggcagccaactggaagatgtacaaaactcgcgctgaagctaaagca
acagctgaggatctgcttacaaaaatcgaaggcaagcttcctgctgaccgtgaagttgtt
atcgcagctccctacaccgctctggaaaccgtaggttccgtgctggcaggaaatgctgat
tgtcatctttccgctgaaaacctttatcctaaggctgaaggcgcattcaccggtgagatc
tctcctgctatgcttaaggatgttggctgtgtatattcactggctggacactccgaacgc
cgcgcaataattggtgaaactgatgagctggtaggtgataaggttgctttcggtcttgag
aacggattgtctatgatcttgtgcatcggtgaaactattgatgaaagaaaagccggggaa
gtacagaaggttattgacgaacagctcgaagctggtttaaagaatgtagcttccgacttc
gctcccgaaaccgttgttgttgcttatgagcccgtttgggccatcggcaccggtgaagtg
gccggcgaaggcgaaatcgttgaagctcacggttttgttagagaaaagctgaaaaaactt
ttccctgaaaaagccaatgaaatccgcatcttgtacggcggaagcgttaaacctgccaac
tgcgcacagatcattgcacttgacaatgtggacggtgtcttggtaggaggcgcgagcttg
gacgcggaaagtttcagccagatcgcactggcttaa

DBGET integrated database retrieval system