KEGG   Desulfovibrio salexigens: Desal_1936Help
Entry
Desal_1936        CDS       T00969                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dsa  Desulfovibrio salexigens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desal_1936
   01230 Biosynthesis of amino acids
    Desal_1936
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desal_1936
   00051 Fructose and mannose metabolism
    Desal_1936
   00562 Inositol phosphate metabolism
    Desal_1936
Enzymes [BR:dsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Desal_1936
Exosome [BR:dsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Desal_1936
  Exosomal proteins of bladder cancer cells
   Desal_1936
  Exosomal proteins of melanoma cells
   Desal_1936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2120130..2120885
Genome map
AA seq 251 aa AA seqDB search
MKKLMAANWKMYKTRAEAKATAEDLLTKIEGKLPADREVVIAAPYTALETVGSVLAGNAD
CHLSAENLYPKAEGAFTGEISPAMLKDVGCVYSLAGHSERRAIIGETDELVGDKVAFGLE
NGLSMILCIGETIDERKAGEVQKVIDEQLEAGLKNVASDFAPETVVVAYEPVWAIGTGEV
AGEGEIVEAHGFVREKLKKLFPEKANEIRILYGGSVKPANCAQIIALDNVDGVLVGGASL
DAESFSQIALA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaatggcagccaactggaagatgtacaaaactcgcgctgaagctaaagca
acagctgaggatctgcttacaaaaatcgaaggcaagcttcctgctgaccgtgaagttgtt
atcgcagctccctacaccgctctggaaaccgtaggttccgtgctggcaggaaatgctgat
tgtcatctttccgctgaaaacctttatcctaaggctgaaggcgcattcaccggtgagatc
tctcctgctatgcttaaggatgttggctgtgtatattcactggctggacactccgaacgc
cgcgcaataattggtgaaactgatgagctggtaggtgataaggttgctttcggtcttgag
aacggattgtctatgatcttgtgcatcggtgaaactattgatgaaagaaaagccggggaa
gtacagaaggttattgacgaacagctcgaagctggtttaaagaatgtagcttccgacttc
gctcccgaaaccgttgttgttgcttatgagcccgtttgggccatcggcaccggtgaagtg
gccggcgaaggcgaaatcgttgaagctcacggttttgttagagaaaagctgaaaaaactt
ttccctgaaaaagccaatgaaatccgcatcttgtacggcggaagcgttaaacctgccaac
tgcgcacagatcattgcacttgacaatgtggacggtgtcttggtaggaggcgcgagcttg
gacgcggaaagtttcagccagatcgcactggcttaa

DBGET integrated database retrieval system