KEGG   Desulfovibrio salexigens: Desal_1951Help
Entry
Desal_1951        CDS       T00969                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
dsa  Desulfovibrio salexigens
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Desal_1951
Enzymes [BR:dsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Desal_1951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2131999..2132445)
Genome map
AA seq 148 aa AA seqDB search
MNQAVARLEKYEGIDPEVWSETYETEPQGLKDQPWFKNQVVRFDVDPELWSAEGFLSTLQ
AVEGQMDRVRDVKNGPRTIDLDIILFGDRVINSGAYLTVPHPRALDRAFVLLPMTDIDPE
LVFPDGTSVTDALKKIDYRTEGNKIYQD
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
ttgaatcaggccgttgctaggctggaaaaatatgaaggtattgatcctgaagtctggtct
gaaacttacgagaccgaacctcagggattgaaagatcagccatggttcaagaatcaggtg
gtccgtttcgatgttgaccccgaactctggtccgcagaaggcttcctttcaacactgcaa
gcagtagaagggcaaatggatcgggtaagggacgttaaaaacggcccccggaccattgat
ctggatattattctcttcggagaccgggttatcaatagtggggcttacctcactgttccg
catcctcgggccctggacagagcgtttgtgcttctgcccatgaccgatatagatccggaa
cttgtattccctgacggaacttccgttactgacgctctgaagaaaattgattaccgcact
gaaggtaataagatttatcaggattaa

DBGET integrated database retrieval system