KEGG   Desulfovibrio salexigens: Desal_2029Help
Entry
Desal_2029        CDS       T00969                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dsa  Desulfovibrio salexigens
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desal_2029
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desal_2029
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Desal_2029
Enzymes [BR:dsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Desal_2029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2219133..2220584
Genome map
AA seq 483 aa AA seqDB search
MTLANEFPEYRGKMEYHCLGCNARYDVNELHYTCPECGSVFILEDLNFDELKKTSGKEWR
EIFDARCATKNDSLRGIFRFYELFAPVMEENEILYLGEGNTPIVASSPALNDVTGIKTAY
KNDGQNPSASFKDRGMACAFSYINTLMNKNNWDEILTVCASTGDTSAAAALYASYMKEGV
KSVVILPQGKVTPQQLAQPLGSGAKVLEVPGVFDDCMKVVENLADNYRVALLNSKNSWRI
LGQESYAFEVAQWYDWDLKDKCIFVPIGNAGNITAIMAGFLKLYELEIITDLPRVFGVQS
AHADPVYRYYSIEDPNEREYQPVKVQPSVAQAAMIGNPVSFPRVKHFAEKFEAIGGKKAF
QVVQVSEQMIMDSMLLANSHGHIACTQGGECFAGLIRAKELGLISENESAVLDSTAHQLK
FIGFQDMYYQNDFPAEYEVTPDSTRANKPELVIEGSEKEKMSEAAYISKAAENVVSMLGL
EKK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgactcttgctaatgaatttccggaatatcgcggtaaaatggaatatcactgtctgggt
tgtaatgcccgttacgacgtgaacgaattacactacacctgccctgaatgcggttctgtt
ttcatccttgaagacctgaatttcgatgaactgaaaaagaccagcggcaaagaatggcgc
gaaatttttgatgcccgttgcgccactaaaaacgacagcctgcgtggtatcttccgcttc
tacgagcttttcgctcccgtaatggaagaaaatgaaatcctttatctcggtgaaggaaac
actcccatcgttgcctccagccccgctcttaatgatgtaaccggaatcaagaccgcatat
aaaaacgacggccagaaccccagtgcatcttttaaagaccgcggaatggcctgtgctttc
agctatattaacactctgatgaacaaaaacaattgggacgagatcctgaccgtttgtgca
tctactggtgatacctccgccgcggcagccctctacgcttcttatatgaaagaaggtgtt
aaatccgtagttatcctgccgcagggcaaagttaccccgcagcagcttgctcagcctttg
ggcagcggtgctaaggtactggaagttcccggtgtatttgatgactgcatgaaagtcgtt
gaaaatctcgctgataactaccgtgtagcgcttctcaactccaagaactcatggcgtatt
ctgggtcaggaatcctacgcttttgaagttgcccagtggtacgattgggatcttaaagac
aaatgtatcttcgtgcctatcggaaacgccggtaacatcactgcaattatggctggcttc
ctcaagctctatgaacttgaaatcatcaccgacctgccccgcgtattcggtgttcagtcc
gcccatgcagacccagtataccgttactattctattgaagatcccaacgagcgtgaatac
cagccggttaaagtacagccttctgtagctcaggcagcaatgatcggaaaccctgtttcc
ttcccgcgcgtgaagcattttgctgagaaatttgaagctatcggcggcaaaaaagcattt
caggttgttcaggtcagcgaacagatgattatggactccatgctactagccaactcccac
ggtcacattgcgtgcactcagggtggtgaatgctttgccggacttattcgggctaaagaa
ctgggcctgattagcgaaaacgaaagcgctgtgctcgattctaccgcacaccaacttaaa
ttcatcggctttcaggacatgtactaccagaacgattttcccgctgaatatgaagtaacc
ccggactctacccgcgccaacaagccagagcttgtaattgaaggaagcgagaaagaaaaa
atgtctgaagcggcttacatttccaaggcagcagaaaacgttgtttccatgctcgggctg
gagaaaaaataa

DBGET integrated database retrieval system