KEGG   Desulfovibrio salexigens: Desal_2434Help
Entry
Desal_2434        CDS       T00969                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
dsa  Desulfovibrio salexigens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Desal_2434
DNA repair and recombination proteins [BR:dsa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Desal_2434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2674617..2675222)
Genome map
AA seq 201 aa AA seqDB search
MENLPEPLRVVAQELAKLPGLGPKSALRIALTMLKMPKEKVTGIGQSVIDLREKLCICEQ
CASITDTCPCRICSDPKREHDKLCLVSEWDSLLAIEEMGLYRGYYLVLGGLLSPLDGVTP
QHLEFQKLEERLEKGEVKELILALGATVDAEATASYIKNMVESKYPGIELSRLAQGIPIG
SEVKYTDKETLRQSLEYRQKL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatttacctgagccgttacgggttgtcgcgcaggaactggcgaaacttcccggt
cttggccccaagtccgcacttcgcattgctttgactatgctgaagatgcccaaagagaaa
gttacgggcattgggcagagcgttattgatctgcgtgaaaagctttgtatctgtgagcag
tgcgccagtattaccgatacttgtccttgcaggatttgttctgatcccaagcgtgagcac
gataagctttgccttgtctcggaatgggattctctgcttgcgattgaagaaatgggcttg
tatcgcggctattatctggttttgggcggccttctttctccgcttgatggtgttacaccg
caacatcttgagtttcagaagcttgaagagcgacttgagaagggcgaagtaaaggaactt
attcttgccttgggtgccacagttgatgccgaggctaccgcttcatatatcaagaatatg
gtggaatccaaataccccggaattgagctttcccgccttgcgcagggtatccccatcgga
tctgaagtgaaatatactgacaaggaaactttgcggcagtcattggaatatcgtcagaaa
ttgtaa

DBGET integrated database retrieval system