KEGG   Desulfovibrio salexigens: Desal_2459Help
Entry
Desal_2459        CDS       T00969                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
dsa  Desulfovibrio salexigens
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desal_2459
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desal_2459
   00052 Galactose metabolism
    Desal_2459
   00500 Starch and sucrose metabolism
    Desal_2459
   00520 Amino sugar and nucleotide sugar metabolism
    Desal_2459
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Desal_2459
   00524 Butirosin and neomycin biosynthesis
    Desal_2459
Enzymes [BR:dsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Desal_2459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2701733..2702689)
Genome map
AA seq 318 aa AA seqDB search
MGLVLAVDIGGTNSRFAAFESGPGHKLVMKETVWLSSVEARSFDHLMEMLAASDFPYSPS
DFDVTVIAVAGPVIGGVYCNVTNVDWDVDFRGGYKKYGFNAAVLINDFAAQAYACRTPAV
EGCRIIHDVEISPIGTVGVIGAGTGLGHCALVPVPVSELGYVPVPSEGGHISFPCQTADE
LDFCEFVMDKRKISYCCGDEVLTGRGLNMLHLYLTGEDLEPKMVAEKMKQGGKTLEWYSR
FTARCCRNYAITVCATGGLYIAGGIVAKNPFVIEQSVFMEEFLDSSSMGDLLKQIPVFLN
DNQESGLYGAALRGVLHI
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgggacttgttcttgccgttgatattggaggcacaaacagtaggtttgccgcatttgag
tccggtcctggccataagctggtcatgaaggaaacagtctggctttccagtgttgaagca
cgcagctttgatcatctcatggaaatgctggcagcgagtgattttccgtattcgccgtca
gattttgatgtcacggttatcgccgtggccggtccggttattggcggcgtttattgcaat
gttaccaatgtagattgggatgttgattttcggggcggttataaaaaatacggtttcaat
gctgccgtgctgatcaatgattttgccgcacaagcctacgcttgccgtactccggctgtg
gaaggatgccggattatccacgatgtcgagatttcaccgattggcacggtgggagtgatt
ggtgccggtaccggactgggccattgtgctttggtccctgttccagtctccgaattgggg
tatgtgcctgtcccgtccgagggcgggcatatcagttttccttgccagactgcagacgag
ttggatttttgtgaattcgttatggataaacgcaaaatttcttattgctgtggtgacgaa
gtgcttaccggacgcggtttgaacatgctgcacctttaccttacaggggaagatcttgaa
ccgaagatggttgccgagaagatgaagcagggcggcaagacccttgaatggtattcccgt
tttaccgcccgctgctgccgcaattatgccattactgtttgcgccaccggaggattgtac
attgccggaggtattgtggctaagaatccatttgtcattgagcagtctgtttttatggaa
gagtttttagattccagttccatgggtgatcttttgaagcagatccctgttttcttaaat
gacaatcaggagagcgggctttacggagctgctttacgcggtgtgctgcatatttaa

DBGET integrated database retrieval system