KEGG   Desulfovibrio salexigens: Desal_2549Help
Entry
Desal_2549        CDS       T00969                                 

Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
dsa  Desulfovibrio salexigens
Pathway
dsa00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Desal_2549
Enzymes [BR:dsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Desal_2549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin DUF498
Motif
Other DBs
NCBI-ProteinID: ACS80605
JGI: Desal_2549
UniProt: C6BY75
Position
complement(2790285..2791211)
Genome map
AA seq 308 aa AA seqDB search
MASPRLIVLGSVNADHVLQVDNFPRPGETVTGHGYQIIPGGKGANQAVAAARLGAEIGFI
ACVGDDDFGRRMINEFQQDGIETSAVMTVEGLPTGIALIQIAAGGENAISISAEANAALT
PEALKPHLGLIREAETLLMQLESPLETIELVAKEAREAGTKVILNPAPARALPDSLLANL
DIITPNETEAELLTGVKVESEDDAAMAACVLHGKGVETVLITLGEKGAFVSRAEGKKLIR
GYKVDPVDTTAAGDTFNGALVASMQKGASLEQAIGFAHGAAAISVTRLGAQTSIPSLEEV
NKFIKDNS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgcccagattaatcgttctcggtagtgtaaatgctgaccatgttttgcaggtg
gataatttcccgcgtcccggcgagaccgttaccgggcatggttatcagatcatacccggc
ggcaagggagctaatcaggcggtggctgcggcccgtcttggtgcggaaatcggttttatt
gcctgtgtgggggatgatgatttcggacggcgtatgatcaatgaatttcagcaggacggg
attgaaacctctgcggttatgactgtggaaggtctgcccaccggaatcgccttgatccag
attgctgccggcggcgagaatgccatttctatttctgctgaagccaatgcagcgcttact
cccgaagctcttaagcctcatcttggtttgatccgcgaagctgaaaccctgcttatgcag
cttgaaagtccgctggaaacaattgagcttgttgcaaaagaagcccgcgaagcaggaaca
aaagtaattttgaatccagcacccgcccgtgccttgcccgattctctgctggcgaatctt
gatataatcactcccaacgaaaccgaagcagaattgcttaccggagtaaaggtggagagt
gaggatgacgctgcaatggctgcttgtgtgttgcacggcaaaggcgttgaaacggtattg
attacacttggtgagaagggggcgtttgtgagccgtgcggaagggaagaagcttatccgc
gggtacaaggttgatcctgtggacacgactgctgccggggatacttttaatggtgcactg
gttgcttccatgcagaagggcgcaagtctcgaacaagctattggttttgcacacggtgcg
gcagcgatttctgtaacccgtcttggcgctcagacttccattcccagccttgaagaagtg
aataaatttataaaggataattcgtaa

DBGET integrated database retrieval system